Edwardsiella tarda: ETAF_0304 Help Entry ETAF_0304         CDS       T02091                                  Name (GenBank) RNA-binding protein Hfq   KO K03666   host factor-I protein Organism etd  Edwardsiella tarda Pathway etd02024   Quorum sensing etd03018   RNA degradation Brite KEGG Orthology (KO) [BR:etd00001]  09120 Genetic Information Processing   09123 Folding, sorting and degradation    03018 RNA degradation     ETAF_0304  09140 Cellular Processes   09145 Cellular community - prokaryotes    02024 Quorum sensing     ETAF_0304  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03019 Messenger RNA biogenesis [BR:etd03019]     ETAF_0304    03036 Chromosome and associated proteins [BR:etd03036]     ETAF_0304 Messenger RNA biogenesis [BR:etd03019]  Prokaryotic type   Bacterial mRNA degradation factors    Other RNA degradation factors     Chaperones      ETAF_0304 Chromosome and associated proteins [BR:etd03036]  Prokaryotic type   Nucleoid associated proteins    Other nucleoid associated proteins     ETAF_0304 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Hfq LSM Hfq_1 Motif Other DBs NCBI-ProteinID:  ADM40428 UniProt:  A0A0H3DMA7 LinkDB All DBs Position 376631..376939 Genome browser AA seq 102 aa AA seqDB search MAKGQSLQDPFLNALRRERVPVSIYLVNGIKLQGQIESFDQFVILLKNTVSQMVYKHAIS TVVPSRPVSHHSGNAGTGSAGSSYHHGGQAASQPTQGSDDAE NT seq 309 nt NT seq  +upstreamnt  +downstreamnt atggctaaggggcaatctttacaagacccgttcttgaacgcgctgcgtcgtgaacgtgtc ccagtttcgatctatttggtgaatggtattaagctgcaaggccagattgagtcttttgat cagtttgtcattctgttgaagaacacggtcagccagatggtctacaaacacgcgatctct accgttgttccgtcccgcccggtttcccaccacagtggcaatgcgggtacgggcagcgca ggcagcagctaccatcacggtggtcaggccgcgtctcagcccactcagggcagtgatgac gctgaataa

DBGET integrated database retrieval system