Edwardsiella anguillarum: ETEE_0061 Help Entry ETEE_0061         CDS       T03245                                  Name (GenBank) DNA damage-inducible protein I   KO K12149   DNA-damage-inducible protein I Organism ete  Edwardsiella anguillarum Brite KEGG Orthology (KO) [BR:ete00001]  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03400 DNA repair and recombination proteins [BR:ete03400]     ETEE_0061 DNA repair and recombination proteins [BR:ete03400]  Prokaryotic type   TLS (translesion DNA synthesis) factors    Other SOS response factors     ETEE_0061 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  DinI DUF7320 Motif Other DBs NCBI-ProteinID:  AIJ06547 UniProt:  A0A076LI06 LinkDB All DBs Position 54724..54972 Genome browser AA seq 82 aa AA seqDB search MRIELTLDKRNPLPPGALDAFHQEFSRRIQRRYPDCAVQVRQAGANGLSVLGGIKSDREI VETILQETWESADDWFSPDYPE NT seq 249 nt NT seq  +upstreamnt  +downstreamnt atgcgcatcgaactgacgttggacaagcgcaaccctctgcctccgggtgcgcttgacgcc tttcaccaggagttttcccgccgcatccagcgccgctaccccgactgcgccgtacaggtg cgccaggccggcgccaacggactgagcgtactgggcggcatcaagagcgatcgggagatc gtcgaaaccatcctgcaggagacctgggaaagcgccgacgactggttctctcccgactac cccgagtag

DBGET integrated database retrieval system