Edwardsiella anguillarum: ETEE_0088 Help Entry ETEE_0088         CDS       T03245                                  Name (GenBank) Acyl carrier protein   KO K02078   acyl carrier protein Organism ete  Edwardsiella anguillarum Pathway ete01100   Metabolic pathways ete01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:ete00001]  09100 Metabolism   09103 Lipid metabolism    00061 Fatty acid biosynthesis     ETEE_0088    00074 Mycolic acid biosynthesis     ETEE_0088   09110 Biosynthesis of other secondary metabolites    00998 Biosynthesis of various antibiotics     ETEE_0088 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  PP-binding PP-binding_2 DUF7080 DUF1896 Ribosomal_L50 HLH Motif Other DBs NCBI-ProteinID:  AIJ06574 UniProt:  A0A076LLN7 LinkDB All DBs Position complement(78971..79207) Genome browser AA seq 78 aa AA seqDB search MSTIEERVKKIIVEQLGVKEDEVVNSASFVDDLGADSLDTVELVMALEEEFDTEIPDEEA EKITTVQAAIDYIEAANK NT seq 237 nt NT seq  +upstreamnt  +downstreamnt atgagcactatcgaagaacgcgttaagaaaatcattgttgaacagctgggtgttaaagaa gacgaagttgtgaattcagcttctttcgttgacgatctgggtgctgattctcttgacacc gttgaactggttatggctctggaagaagagtttgatactgagattccggacgaagaagca gagaagatcaccactgttcaggccgctatcgactacatcgaagctgcaaacaagtaa

DBGET integrated database retrieval system