KEGG   Edwardsiella anguillarum: ETEE_0224
Entry
ETEE_0224         CDS       T03245                                 
Symbol
artI
Name
(GenBank) Arginine ABC transporter, periplasmic arginine-binding protein ArtI
  KO
K09997  arginine transport system substrate-binding protein
Organism
ete  Edwardsiella anguillarum
Pathway
ete02010  ABC transporters
Brite
KEGG Orthology (KO) [BR:ete00001]
 09130 Environmental Information Processing
  09131 Membrane transport
   02010 ABC transporters
    ETEE_0224 (artI)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:ete02000]
    ETEE_0224 (artI)
Transporters [BR:ete02000]
 ABC transporters, prokaryotic type
  Phosphate and amino acid transporters
   Arginine transporter
    ETEE_0224 (artI)
SSDB
Motif
Pfam: SBP_bac_3 Lig_chan-Glu_bd Phosphonate-bd YhfZ_C NMT1
Other DBs
NCBI-ProteinID: AIJ06705
UniProt: A0A076LDW7
LinkDB
Position
208654..209385
AA seq 243 aa
MKKIIIAAMLAGISVSATAAQTIRFAAEASYPPFEFMDAQNKMQGFDVDLANAICQQMKA
TCTFSNQSFDSLIPSLKFKRVDAVISGMDITPERQKQVDFSQPYYDNSALFIAEKGKVDN
VAALKGKRVGIQNGTTHQKYLMDKHPELTPVPYDSYQNAILDLKNGRIDAVFGDTAVVNE
WMKQNPNLAPVGTKVTDADYFGTGLGIAVRKGNAPLLEQFNAALNQLKQDGQYQAIYDKW
FQK
NT seq 732 nt   +upstreamnt  +downstreamnt
atgaaaaaaatcataattgctgcgatgttagccggtatcagcgtctctgccacggcggcg
caaaccatccgttttgccgccgaagcctcgtatccgccgttcgaatttatggatgcgcag
aataaaatgcagggctttgacgtcgatctggccaacgccatctgtcagcagatgaaggcc
acctgtaccttcagcaaccagtccttcgacagcctgatccccagcctgaagttcaagcgc
gtcgatgcggtgatctccgggatggacatcacgccggagcggcagaagcaggtcgacttc
tcccagccctactatgacaactccgcgctgttcatcgccgaaaaaggcaaggtggacaac
gtggccgcgctgaagggcaagcgggtcgggatccagaacggcaccacccatcaaaaatac
ctgatggataaacaccccgagctgacgccggtgccctatgacagctaccagaacgccatc
ctcgacctgaagaatggccggatcgatgcagtgttcggcgatacggcggtggtcaatgag
tggatgaagcaaaaccccaatctggcgccggtcggtacgaaggtcaccgatgcagactat
ttcggtaccgggctagggatcgccgtgcgcaagggcaacgccccgctgctagaacagttc
aacgcggcgctgaaccagctcaaacaggatggccaatatcaggctatctatgacaagtgg
tttcagaagtaa

DBGET integrated database retrieval system