Edwardsiella anguillarum: ETEE_2710 Help Entry ETEE_2710         CDS       T03245                                  Name (GenBank) Acyl carrier protein (ACP1)   KO K02078   acyl carrier protein Organism ete  Edwardsiella anguillarum Pathway ete01100   Metabolic pathways ete01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:ete00001]  09100 Metabolism   09103 Lipid metabolism    00061 Fatty acid biosynthesis     ETEE_2710    00074 Mycolic acid biosynthesis     ETEE_2710   09110 Biosynthesis of other secondary metabolites    00998 Biosynthesis of various antibiotics     ETEE_2710 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  PP-binding Motif Other DBs NCBI-ProteinID:  AIJ09143 UniProt:  A0A076LRG4 LinkDB All DBs Position complement(2748615..2748872) Genome browser AA seq 85 aa AA seqDB search MQALYLEIKNLIINTLNLDELSTDDIDTDAALFGDGLGLDSIDALELGLAVKNQYGIVLS AESEEMRQHFYSVATLAAFIHSQRA NT seq 258 nt NT seq  +upstreamnt  +downstreamnt atgcaagcgctttaccttgaaattaaaaatctcattattaacacgttaaatctggacgag ctgagcaccgatgacatcgacaccgatgccgcgctgttcggggatgggttaggtctggac tctatcgatgcattagagctgggtctggcggtgaaaaatcagtacggcatcgtcctgtcc gccgagagcgaagagatgcgccagcatttctactccgtggcgacgctggccgcttttatt cattcacaacgcgcctga

DBGET integrated database retrieval system