Echinops telfairi (small Madagascar hedgehog): 101642903
Help
Entry
101642903 CDS
T08707
Name
(RefSeq) acyl carrier protein, mitochondrial
KO
K03955
NADH dehydrogenase (ubiquinone) 1 alpha/beta subcomplex 1, acyl-carrier protein
Organism
etf
Echinops telfairi (small Madagascar hedgehog)
Pathway
etf00190
Oxidative phosphorylation
etf01100
Metabolic pathways
etf04714
Thermogenesis
etf04723
Retrograde endocannabinoid signaling
etf04932
Non-alcoholic fatty liver disease
etf05010
Alzheimer disease
etf05012
Parkinson disease
etf05014
Amyotrophic lateral sclerosis
etf05016
Huntington disease
etf05020
Prion disease
etf05022
Pathways of neurodegeneration - multiple diseases
etf05208
Chemical carcinogenesis - reactive oxygen species
etf05415
Diabetic cardiomyopathy
Module
etf_M00873
Fatty acid biosynthesis in mitochondria, animals
Brite
KEGG Orthology (KO) [BR:
etf00001
]
09100 Metabolism
09102 Energy metabolism
00190 Oxidative phosphorylation
101642903
09103 Lipid metabolism
00061 Fatty acid biosynthesis
101642903
09150 Organismal Systems
09156 Nervous system
04723 Retrograde endocannabinoid signaling
101642903
09159 Environmental adaptation
04714 Thermogenesis
101642903
09160 Human Diseases
09161 Cancer: overview
05208 Chemical carcinogenesis - reactive oxygen species
101642903
09164 Neurodegenerative disease
05010 Alzheimer disease
101642903
05012 Parkinson disease
101642903
05014 Amyotrophic lateral sclerosis
101642903
05016 Huntington disease
101642903
05020 Prion disease
101642903
05022 Pathways of neurodegeneration - multiple diseases
101642903
09166 Cardiovascular disease
05415 Diabetic cardiomyopathy
101642903
09167 Endocrine and metabolic disease
04932 Non-alcoholic fatty liver disease
101642903
BRITE hierarchy
SSDB
Ortholog
Paralog
GFIT
Motif
Pfam:
PP-binding
PP-binding_2
DUF7080
Motif
Other DBs
NCBI-GeneID:
101642903
NCBI-ProteinID:
XP_012862489
UniProt:
A0ABM0ZSP9
LinkDB
All DBs
Position
Unknown
AA seq
129 aa
AA seq
DB search
VARPLSTTLFPSGIRTSPRAPRSVSVLVQAPGRVTQLCRRYSDAPPLTLEGIKDRVLYVL
KLYDKIDPKELSVNSHFMKDLGLDSLDQVEIIMAMEDEFGFEIPDIDAEKLMCPQKIVDY
IADKKDVYE
NT seq
390 nt
NT seq
+upstream
nt +downstream
nt
gtggcccggccactcagcactactctgttcccctctgggatccggacgagtcccagggct
ccgcggtcggtctcggtgctcgtgcaggctcctggtagagttacacagctctgtcgccgg
tatagtgatgcaccaccattgacgttagaaggaatcaaggaccgtgttctttatgtcttg
aaactctatgataagattgaccccaaagaactttcagtaaattcccattttatgaaagac
ctgggtttagacagtttggaccaagtggagattatcatggccatggaagacgaatttggt
tttgaaattccggatatagatgcagaaaagttaatgtgcccacaaaaaattgtagattac
attgcagataagaaggatgtatatgaataa
DBGET
integrated database retrieval system