Echinops telfairi (small Madagascar hedgehog): 101644152
Help
Entry
101644152 CDS
T08707
Symbol
PGAM2
Name
(RefSeq) phosphoglycerate mutase 2
KO
K01834
2,3-bisphosphoglycerate-dependent phosphoglycerate mutase [EC:
5.4.2.11
]
Organism
etf
Echinops telfairi (small Madagascar hedgehog)
Pathway
etf00010
Glycolysis / Gluconeogenesis
etf00260
Glycine, serine and threonine metabolism
etf01100
Metabolic pathways
etf01200
Carbon metabolism
etf01230
Biosynthesis of amino acids
etf04922
Glucagon signaling pathway
etf05230
Central carbon metabolism in cancer
Module
etf_M00001
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
etf_M00002
Glycolysis, core module involving three-carbon compounds
etf_M00003
Gluconeogenesis, oxaloacetate => fructose-6P
Brite
KEGG Orthology (KO) [BR:
etf00001
]
09100 Metabolism
09101 Carbohydrate metabolism
00010 Glycolysis / Gluconeogenesis
101644152 (PGAM2)
09105 Amino acid metabolism
00260 Glycine, serine and threonine metabolism
101644152 (PGAM2)
09150 Organismal Systems
09152 Endocrine system
04922 Glucagon signaling pathway
101644152 (PGAM2)
09160 Human Diseases
09161 Cancer: overview
05230 Central carbon metabolism in cancer
101644152 (PGAM2)
09180 Brite Hierarchies
09182 Protein families: genetic information processing
04131 Membrane trafficking [BR:
etf04131
]
101644152 (PGAM2)
09183 Protein families: signaling and cellular processes
04147 Exosome [BR:
etf04147
]
101644152 (PGAM2)
Enzymes [BR:
etf01000
]
5. Isomerases
5.4 Intramolecular transferases
5.4.2 Phosphotransferases (phosphomutases)
5.4.2.11 phosphoglycerate mutase (2,3-diphosphoglycerate-dependent)
101644152 (PGAM2)
Membrane trafficking [BR:
etf04131
]
Autophagy
Chaperone mediated autophagy (CMA)
Selective cargos
101644152 (PGAM2)
Exosome [BR:
etf04147
]
Exosomal proteins
Exosomal proteins of bladder cancer cells
101644152 (PGAM2)
Exosomal proteins of melanoma cells
101644152 (PGAM2)
BRITE hierarchy
SSDB
Ortholog
Paralog
GFIT
Motif
Pfam:
His_Phos_1
Motif
Other DBs
NCBI-GeneID:
101644152
NCBI-ProteinID:
XP_012861511
UniProt:
A0ABM0ZRS2
LinkDB
All DBs
Position
Unknown
AA seq
253 aa
AA seq
DB search
MSTHRLVIVRHGESTWNQENRFCGWFDAELSEKGAEEAKRGALAIRDAKMEFDICYTSVL
KRAIRTLWTILDGTDQMWLPVVRTWRLNERHYGGLTGLNKAETAAKHGEEQVKIWRRSFD
IPPPPMDEKHPYYTTITKERRYAGLKPGELPACESLKDTIARALPFWNEEIAPQIKAGKR
VLIAAHGNSLRGIVKHLEGMSDQAIMELNLPTGIPIVYELDAGLKPTKPMQFLGDEETVR
KAMEAVAAQGKAK
NT seq
762 nt
NT seq
+upstream
nt +downstream
nt
atgtccacccaccgcctggtgatcgtgcgtcacggggagagcacatggaaccaggagaac
cgcttctgtggctggttcgacgcggagctgagcgagaagggcgctgaggaggccaagcgg
ggcgccctcgccatcagggatgccaagatggagtttgacatatgctacacctcggtgctg
aagcgggccatccgcacactctggaccatcctggatggcaccgaccagatgtggctgcct
gtggttcgcacctggcgcctcaacgagcggcactacgggggcctcaccggcctcaacaag
gcagagacagctgccaagcacggtgaggagcaggtgaagatctggaggcgctcttttgac
atcccaccgccccccatggatgagaagcacccctactataccaccatcaccaaggaacgt
cggtacgcaggcctgaagcctggagagctgcccgcctgtgaaagcctgaaagacaccatt
gcccgggccctgcccttctggaatgaggagattgccccccaaatcaaggctggcaagcga
gtgctcattgctgcccatggcaacagccttcggggcatcgttaagcacctggaaggaatg
tccgaccaggccatcatggagctgaacctgcccacgggcatccccatcgtgtatgagctg
gatgcagggctgaagcccaccaagccaatgcagttcctgggggacgaggagacggtgcgg
aaagccatggaagccgtggcagcccagggcaaggccaagtga
DBGET
integrated database retrieval system