KEGG   Echinops telfairi (small Madagascar hedgehog): 101644576
Entry
101644576         CDS       T08707                                 
Symbol
RAC1
Name
(RefSeq) ras-related C3 botulinum toxin substrate 1
  KO
K04392  Ras-related C3 botulinum toxin substrate 1
Organism
etf  Echinops telfairi (small Madagascar hedgehog)
Pathway
etf04010  MAPK signaling pathway
etf04014  Ras signaling pathway
etf04015  Rap1 signaling pathway
etf04024  cAMP signaling pathway
etf04062  Chemokine signaling pathway
etf04071  Sphingolipid signaling pathway
etf04145  Phagosome
etf04148  Efferocytosis
etf04151  PI3K-Akt signaling pathway
etf04310  Wnt signaling pathway
etf04360  Axon guidance
etf04370  VEGF signaling pathway
etf04380  Osteoclast differentiation
etf04510  Focal adhesion
etf04520  Adherens junction
etf04530  Tight junction
etf04613  Neutrophil extracellular trap formation
etf04620  Toll-like receptor signaling pathway
etf04650  Natural killer cell mediated cytotoxicity
etf04662  B cell receptor signaling pathway
etf04664  Fc epsilon RI signaling pathway
etf04666  Fc gamma R-mediated phagocytosis
etf04670  Leukocyte transendothelial migration
etf04722  Neurotrophin signaling pathway
etf04810  Regulation of actin cytoskeleton
etf04932  Non-alcoholic fatty liver disease
etf04933  AGE-RAGE signaling pathway in diabetic complications
etf04972  Pancreatic secretion
etf05014  Amyotrophic lateral sclerosis
etf05020  Prion disease
etf05022  Pathways of neurodegeneration - multiple diseases
etf05100  Bacterial invasion of epithelial cells
etf05132  Salmonella infection
etf05135  Yersinia infection
etf05163  Human cytomegalovirus infection
etf05167  Kaposi sarcoma-associated herpesvirus infection
etf05169  Epstein-Barr virus infection
etf05170  Human immunodeficiency virus 1 infection
etf05200  Pathways in cancer
etf05203  Viral carcinogenesis
etf05205  Proteoglycans in cancer
etf05208  Chemical carcinogenesis - reactive oxygen species
etf05210  Colorectal cancer
etf05211  Renal cell carcinoma
etf05212  Pancreatic cancer
etf05231  Choline metabolism in cancer
etf05415  Diabetic cardiomyopathy
etf05416  Viral myocarditis
etf05417  Lipid and atherosclerosis
etf05418  Fluid shear stress and atherosclerosis
Brite
KEGG Orthology (KO) [BR:etf00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    101644576 (RAC1)
   04014 Ras signaling pathway
    101644576 (RAC1)
   04015 Rap1 signaling pathway
    101644576 (RAC1)
   04310 Wnt signaling pathway
    101644576 (RAC1)
   04370 VEGF signaling pathway
    101644576 (RAC1)
   04071 Sphingolipid signaling pathway
    101644576 (RAC1)
   04024 cAMP signaling pathway
    101644576 (RAC1)
   04151 PI3K-Akt signaling pathway
    101644576 (RAC1)
 09140 Cellular Processes
  09141 Transport and catabolism
   04145 Phagosome
    101644576 (RAC1)
   04148 Efferocytosis
    101644576 (RAC1)
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    101644576 (RAC1)
   04520 Adherens junction
    101644576 (RAC1)
   04530 Tight junction
    101644576 (RAC1)
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    101644576 (RAC1)
 09150 Organismal Systems
  09151 Immune system
   04613 Neutrophil extracellular trap formation
    101644576 (RAC1)
   04620 Toll-like receptor signaling pathway
    101644576 (RAC1)
   04650 Natural killer cell mediated cytotoxicity
    101644576 (RAC1)
   04662 B cell receptor signaling pathway
    101644576 (RAC1)
   04664 Fc epsilon RI signaling pathway
    101644576 (RAC1)
   04666 Fc gamma R-mediated phagocytosis
    101644576 (RAC1)
   04670 Leukocyte transendothelial migration
    101644576 (RAC1)
   04062 Chemokine signaling pathway
    101644576 (RAC1)
  09154 Digestive system
   04972 Pancreatic secretion
    101644576 (RAC1)
  09156 Nervous system
   04722 Neurotrophin signaling pathway
    101644576 (RAC1)
  09158 Development and regeneration
   04360 Axon guidance
    101644576 (RAC1)
   04380 Osteoclast differentiation
    101644576 (RAC1)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    101644576 (RAC1)
   05205 Proteoglycans in cancer
    101644576 (RAC1)
   05208 Chemical carcinogenesis - reactive oxygen species
    101644576 (RAC1)
   05203 Viral carcinogenesis
    101644576 (RAC1)
   05231 Choline metabolism in cancer
    101644576 (RAC1)
  09162 Cancer: specific types
   05210 Colorectal cancer
    101644576 (RAC1)
   05212 Pancreatic cancer
    101644576 (RAC1)
   05211 Renal cell carcinoma
    101644576 (RAC1)
  09172 Infectious disease: viral
   05170 Human immunodeficiency virus 1 infection
    101644576 (RAC1)
   05163 Human cytomegalovirus infection
    101644576 (RAC1)
   05167 Kaposi sarcoma-associated herpesvirus infection
    101644576 (RAC1)
   05169 Epstein-Barr virus infection
    101644576 (RAC1)
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    101644576 (RAC1)
   05135 Yersinia infection
    101644576 (RAC1)
   05100 Bacterial invasion of epithelial cells
    101644576 (RAC1)
  09164 Neurodegenerative disease
   05014 Amyotrophic lateral sclerosis
    101644576 (RAC1)
   05020 Prion disease
    101644576 (RAC1)
   05022 Pathways of neurodegeneration - multiple diseases
    101644576 (RAC1)
  09166 Cardiovascular disease
   05417 Lipid and atherosclerosis
    101644576 (RAC1)
   05418 Fluid shear stress and atherosclerosis
    101644576 (RAC1)
   05415 Diabetic cardiomyopathy
    101644576 (RAC1)
   05416 Viral myocarditis
    101644576 (RAC1)
  09167 Endocrine and metabolic disease
   04932 Non-alcoholic fatty liver disease
    101644576 (RAC1)
   04933 AGE-RAGE signaling pathway in diabetic complications
    101644576 (RAC1)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:etf04131]
    101644576 (RAC1)
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:etf04147]
    101644576 (RAC1)
   04031 GTP-binding proteins [BR:etf04031]
    101644576 (RAC1)
Membrane trafficking [BR:etf04131]
 Exocytosis
  Small GTPases and associated proteins
   Rho GTPases
    101644576 (RAC1)
 Endocytosis
  Lipid raft mediated endocytosis
   Arf6-dependent endocytosis
    101644576 (RAC1)
  Macropinocytosis
   Ras GTPases
    101644576 (RAC1)
 Others
  NADPH oxidases (Nox) and associated proteins
   Nox associated proteins
    101644576 (RAC1)
Exosome [BR:etf04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   101644576 (RAC1)
  Exosomal proteins of other body fluids (saliva and urine)
   101644576 (RAC1)
  Exosomal proteins of colorectal cancer cells
   101644576 (RAC1)
  Exosomal proteins of bladder cancer cells
   101644576 (RAC1)
GTP-binding proteins [BR:etf04031]
 Small (monomeric) G-proteins
  Rho Family
   Rac/Cdc42 [OT]
    101644576 (RAC1)
SSDB
Motif
Pfam: Ras Roc Arf
Other DBs
NCBI-GeneID: 101644576
NCBI-ProteinID: XP_045140372
LinkDB
Position
Unknown
AA seq 148 aa
MRQTFAAISPFFKQNNGSPGLCHKSRSTLCRLSDSAPPVFSLFLRAVGKTCLLISYTTNA
FPGEYIPTVFDNYSANVMVDGKPVNLGLWDTAGQEDYDRLRPLSYPQTDVFLICFSLVSP
ASFENVRAKVREGLFFGLFLLTVTRGTE
NT seq 447 nt   +upstreamnt  +downstreamnt
atgcgacaaacatttgcagccatcagcccattttttaaacagaataacggaagcccagga
ctctgtcataagagcaggtcaacattatgtcgactaagtgactcagcaccacctgtcttt
tctctttttcttagagccgtaggtaaaacgtgcctgctgatcagctacaccaccaatgcg
tttcctggagaatacatccccaccgtctttgacaactactctgccaatgttatggtagat
gggaaaccggtgaatctgggcctgtgggatacagctggccaggaagattacgaccgatta
cgtcctctctcctatccgcaaacagacgtgttcttaatctgcttctccctggtgagtcct
gcatcatttgaaaatgtccgggcaaaggtacgtgaggggttattttttggtctgttttta
cttactgtcactcgaggtacagagtag

DBGET integrated database retrieval system