KEGG   Echinops telfairi (small Madagascar hedgehog): 101648971
Entry
101648971         CDS       T08707                                 
Symbol
MAPK3
Name
(RefSeq) mitogen-activated protein kinase 3
  KO
K04371  mitogen-activated protein kinase 1/3 [EC:2.7.11.24]
Organism
etf  Echinops telfairi (small Madagascar hedgehog)
Pathway
etf01521  EGFR tyrosine kinase inhibitor resistance
etf01522  Endocrine resistance
etf01524  Platinum drug resistance
etf04010  MAPK signaling pathway
etf04012  ErbB signaling pathway
etf04014  Ras signaling pathway
etf04015  Rap1 signaling pathway
etf04022  cGMP-PKG signaling pathway
etf04024  cAMP signaling pathway
etf04062  Chemokine signaling pathway
etf04066  HIF-1 signaling pathway
etf04068  FoxO signaling pathway
etf04071  Sphingolipid signaling pathway
etf04072  Phospholipase D signaling pathway
etf04114  Oocyte meiosis
etf04140  Autophagy - animal
etf04148  Efferocytosis
etf04150  mTOR signaling pathway
etf04151  PI3K-Akt signaling pathway
etf04210  Apoptosis
etf04218  Cellular senescence
etf04261  Adrenergic signaling in cardiomyocytes
etf04270  Vascular smooth muscle contraction
etf04350  TGF-beta signaling pathway
etf04360  Axon guidance
etf04370  VEGF signaling pathway
etf04371  Apelin signaling pathway
etf04380  Osteoclast differentiation
etf04510  Focal adhesion
etf04520  Adherens junction
etf04540  Gap junction
etf04550  Signaling pathways regulating pluripotency of stem cells
etf04611  Platelet activation
etf04613  Neutrophil extracellular trap formation
etf04620  Toll-like receptor signaling pathway
etf04621  NOD-like receptor signaling pathway
etf04625  C-type lectin receptor signaling pathway
etf04650  Natural killer cell mediated cytotoxicity
etf04657  IL-17 signaling pathway
etf04658  Th1 and Th2 cell differentiation
etf04659  Th17 cell differentiation
etf04660  T cell receptor signaling pathway
etf04662  B cell receptor signaling pathway
etf04664  Fc epsilon RI signaling pathway
etf04666  Fc gamma R-mediated phagocytosis
etf04668  TNF signaling pathway
etf04713  Circadian entrainment
etf04720  Long-term potentiation
etf04722  Neurotrophin signaling pathway
etf04723  Retrograde endocannabinoid signaling
etf04724  Glutamatergic synapse
etf04725  Cholinergic synapse
etf04726  Serotonergic synapse
etf04730  Long-term depression
etf04810  Regulation of actin cytoskeleton
etf04910  Insulin signaling pathway
etf04912  GnRH signaling pathway
etf04914  Progesterone-mediated oocyte maturation
etf04915  Estrogen signaling pathway
etf04916  Melanogenesis
etf04917  Prolactin signaling pathway
etf04919  Thyroid hormone signaling pathway
etf04921  Oxytocin signaling pathway
etf04926  Relaxin signaling pathway
etf04928  Parathyroid hormone synthesis, secretion and action
etf04929  GnRH secretion
etf04930  Type II diabetes mellitus
etf04933  AGE-RAGE signaling pathway in diabetic complications
etf04934  Cushing syndrome
etf04935  Growth hormone synthesis, secretion and action
etf04960  Aldosterone-regulated sodium reabsorption
etf05010  Alzheimer disease
etf05020  Prion disease
etf05022  Pathways of neurodegeneration - multiple diseases
etf05034  Alcoholism
etf05132  Salmonella infection
etf05133  Pertussis
etf05135  Yersinia infection
etf05140  Leishmaniasis
etf05142  Chagas disease
etf05145  Toxoplasmosis
etf05152  Tuberculosis
etf05160  Hepatitis C
etf05161  Hepatitis B
etf05163  Human cytomegalovirus infection
etf05164  Influenza A
etf05165  Human papillomavirus infection
etf05166  Human T-cell leukemia virus 1 infection
etf05167  Kaposi sarcoma-associated herpesvirus infection
etf05170  Human immunodeficiency virus 1 infection
etf05171  Coronavirus disease - COVID-19
etf05200  Pathways in cancer
etf05203  Viral carcinogenesis
etf05205  Proteoglycans in cancer
etf05206  MicroRNAs in cancer
etf05207  Chemical carcinogenesis - receptor activation
etf05208  Chemical carcinogenesis - reactive oxygen species
etf05210  Colorectal cancer
etf05211  Renal cell carcinoma
etf05212  Pancreatic cancer
etf05213  Endometrial cancer
etf05214  Glioma
etf05215  Prostate cancer
etf05216  Thyroid cancer
etf05218  Melanoma
etf05219  Bladder cancer
etf05220  Chronic myeloid leukemia
etf05221  Acute myeloid leukemia
etf05223  Non-small cell lung cancer
etf05224  Breast cancer
etf05225  Hepatocellular carcinoma
etf05226  Gastric cancer
etf05230  Central carbon metabolism in cancer
etf05231  Choline metabolism in cancer
etf05235  PD-L1 expression and PD-1 checkpoint pathway in cancer
etf05417  Lipid and atherosclerosis
Brite
KEGG Orthology (KO) [BR:etf00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    101648971 (MAPK3)
   04012 ErbB signaling pathway
    101648971 (MAPK3)
   04014 Ras signaling pathway
    101648971 (MAPK3)
   04015 Rap1 signaling pathway
    101648971 (MAPK3)
   04350 TGF-beta signaling pathway
    101648971 (MAPK3)
   04370 VEGF signaling pathway
    101648971 (MAPK3)
   04371 Apelin signaling pathway
    101648971 (MAPK3)
   04668 TNF signaling pathway
    101648971 (MAPK3)
   04066 HIF-1 signaling pathway
    101648971 (MAPK3)
   04068 FoxO signaling pathway
    101648971 (MAPK3)
   04072 Phospholipase D signaling pathway
    101648971 (MAPK3)
   04071 Sphingolipid signaling pathway
    101648971 (MAPK3)
   04024 cAMP signaling pathway
    101648971 (MAPK3)
   04022 cGMP-PKG signaling pathway
    101648971 (MAPK3)
   04151 PI3K-Akt signaling pathway
    101648971 (MAPK3)
   04150 mTOR signaling pathway
    101648971 (MAPK3)
 09140 Cellular Processes
  09141 Transport and catabolism
   04140 Autophagy - animal
    101648971 (MAPK3)
   04148 Efferocytosis
    101648971 (MAPK3)
  09143 Cell growth and death
   04114 Oocyte meiosis
    101648971 (MAPK3)
   04210 Apoptosis
    101648971 (MAPK3)
   04218 Cellular senescence
    101648971 (MAPK3)
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    101648971 (MAPK3)
   04520 Adherens junction
    101648971 (MAPK3)
   04540 Gap junction
    101648971 (MAPK3)
   04550 Signaling pathways regulating pluripotency of stem cells
    101648971 (MAPK3)
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    101648971 (MAPK3)
 09150 Organismal Systems
  09151 Immune system
   04611 Platelet activation
    101648971 (MAPK3)
   04613 Neutrophil extracellular trap formation
    101648971 (MAPK3)
   04620 Toll-like receptor signaling pathway
    101648971 (MAPK3)
   04621 NOD-like receptor signaling pathway
    101648971 (MAPK3)
   04625 C-type lectin receptor signaling pathway
    101648971 (MAPK3)
   04650 Natural killer cell mediated cytotoxicity
    101648971 (MAPK3)
   04660 T cell receptor signaling pathway
    101648971 (MAPK3)
   04658 Th1 and Th2 cell differentiation
    101648971 (MAPK3)
   04659 Th17 cell differentiation
    101648971 (MAPK3)
   04657 IL-17 signaling pathway
    101648971 (MAPK3)
   04662 B cell receptor signaling pathway
    101648971 (MAPK3)
   04664 Fc epsilon RI signaling pathway
    101648971 (MAPK3)
   04666 Fc gamma R-mediated phagocytosis
    101648971 (MAPK3)
   04062 Chemokine signaling pathway
    101648971 (MAPK3)
  09152 Endocrine system
   04910 Insulin signaling pathway
    101648971 (MAPK3)
   04929 GnRH secretion
    101648971 (MAPK3)
   04912 GnRH signaling pathway
    101648971 (MAPK3)
   04915 Estrogen signaling pathway
    101648971 (MAPK3)
   04914 Progesterone-mediated oocyte maturation
    101648971 (MAPK3)
   04917 Prolactin signaling pathway
    101648971 (MAPK3)
   04921 Oxytocin signaling pathway
    101648971 (MAPK3)
   04926 Relaxin signaling pathway
    101648971 (MAPK3)
   04935 Growth hormone synthesis, secretion and action
    101648971 (MAPK3)
   04919 Thyroid hormone signaling pathway
    101648971 (MAPK3)
   04928 Parathyroid hormone synthesis, secretion and action
    101648971 (MAPK3)
   04916 Melanogenesis
    101648971 (MAPK3)
  09153 Circulatory system
   04261 Adrenergic signaling in cardiomyocytes
    101648971 (MAPK3)
   04270 Vascular smooth muscle contraction
    101648971 (MAPK3)
  09155 Excretory system
   04960 Aldosterone-regulated sodium reabsorption
    101648971 (MAPK3)
  09156 Nervous system
   04724 Glutamatergic synapse
    101648971 (MAPK3)
   04725 Cholinergic synapse
    101648971 (MAPK3)
   04726 Serotonergic synapse
    101648971 (MAPK3)
   04720 Long-term potentiation
    101648971 (MAPK3)
   04730 Long-term depression
    101648971 (MAPK3)
   04723 Retrograde endocannabinoid signaling
    101648971 (MAPK3)
   04722 Neurotrophin signaling pathway
    101648971 (MAPK3)
  09158 Development and regeneration
   04360 Axon guidance
    101648971 (MAPK3)
   04380 Osteoclast differentiation
    101648971 (MAPK3)
  09159 Environmental adaptation
   04713 Circadian entrainment
    101648971 (MAPK3)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    101648971 (MAPK3)
   05206 MicroRNAs in cancer
    101648971 (MAPK3)
   05205 Proteoglycans in cancer
    101648971 (MAPK3)
   05207 Chemical carcinogenesis - receptor activation
    101648971 (MAPK3)
   05208 Chemical carcinogenesis - reactive oxygen species
    101648971 (MAPK3)
   05203 Viral carcinogenesis
    101648971 (MAPK3)
   05230 Central carbon metabolism in cancer
    101648971 (MAPK3)
   05231 Choline metabolism in cancer
    101648971 (MAPK3)
   05235 PD-L1 expression and PD-1 checkpoint pathway in cancer
    101648971 (MAPK3)
  09162 Cancer: specific types
   05210 Colorectal cancer
    101648971 (MAPK3)
   05212 Pancreatic cancer
    101648971 (MAPK3)
   05225 Hepatocellular carcinoma
    101648971 (MAPK3)
   05226 Gastric cancer
    101648971 (MAPK3)
   05214 Glioma
    101648971 (MAPK3)
   05216 Thyroid cancer
    101648971 (MAPK3)
   05221 Acute myeloid leukemia
    101648971 (MAPK3)
   05220 Chronic myeloid leukemia
    101648971 (MAPK3)
   05218 Melanoma
    101648971 (MAPK3)
   05211 Renal cell carcinoma
    101648971 (MAPK3)
   05219 Bladder cancer
    101648971 (MAPK3)
   05215 Prostate cancer
    101648971 (MAPK3)
   05213 Endometrial cancer
    101648971 (MAPK3)
   05224 Breast cancer
    101648971 (MAPK3)
   05223 Non-small cell lung cancer
    101648971 (MAPK3)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    101648971 (MAPK3)
   05170 Human immunodeficiency virus 1 infection
    101648971 (MAPK3)
   05161 Hepatitis B
    101648971 (MAPK3)
   05160 Hepatitis C
    101648971 (MAPK3)
   05171 Coronavirus disease - COVID-19
    101648971 (MAPK3)
   05164 Influenza A
    101648971 (MAPK3)
   05163 Human cytomegalovirus infection
    101648971 (MAPK3)
   05167 Kaposi sarcoma-associated herpesvirus infection
    101648971 (MAPK3)
   05165 Human papillomavirus infection
    101648971 (MAPK3)
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    101648971 (MAPK3)
   05135 Yersinia infection
    101648971 (MAPK3)
   05133 Pertussis
    101648971 (MAPK3)
   05152 Tuberculosis
    101648971 (MAPK3)
  09174 Infectious disease: parasitic
   05145 Toxoplasmosis
    101648971 (MAPK3)
   05140 Leishmaniasis
    101648971 (MAPK3)
   05142 Chagas disease
    101648971 (MAPK3)
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    101648971 (MAPK3)
   05020 Prion disease
    101648971 (MAPK3)
   05022 Pathways of neurodegeneration - multiple diseases
    101648971 (MAPK3)
  09165 Substance dependence
   05034 Alcoholism
    101648971 (MAPK3)
  09166 Cardiovascular disease
   05417 Lipid and atherosclerosis
    101648971 (MAPK3)
  09167 Endocrine and metabolic disease
   04930 Type II diabetes mellitus
    101648971 (MAPK3)
   04933 AGE-RAGE signaling pathway in diabetic complications
    101648971 (MAPK3)
   04934 Cushing syndrome
    101648971 (MAPK3)
  09176 Drug resistance: antineoplastic
   01521 EGFR tyrosine kinase inhibitor resistance
    101648971 (MAPK3)
   01524 Platinum drug resistance
    101648971 (MAPK3)
   01522 Endocrine resistance
    101648971 (MAPK3)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:etf01001]
    101648971 (MAPK3)
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:etf03036]
    101648971 (MAPK3)
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:etf04147]
    101648971 (MAPK3)
Enzymes [BR:etf01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.24  mitogen-activated protein kinase
     101648971 (MAPK3)
Protein kinases [BR:etf01001]
 Serine/threonine kinases: CMGC group
  MAPK family [OT]
   101648971 (MAPK3)
Chromosome and associated proteins [BR:etf03036]
 Eukaryotic type
  Centromeric chromatin formation proteins
   SAC (spindle assembly checkpoint) factors
    Protein kinases
     101648971 (MAPK3)
Exosome [BR:etf04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   101648971 (MAPK3)
SSDB
Motif
Pfam: Pkinase PK_Tyr_Ser-Thr APH ABC1 Haspin_kinase FTA2 Kdo
Other DBs
NCBI-GeneID: 101648971
NCBI-ProteinID: XP_004705746
LinkDB
Position
Unknown
AA seq 452 aa
MARLCLLLPPQVAQCTHRPLQAAHPLPPGPQPYLLPEMTMSLRVEDEEVEEEAPRLGLHP
GSLVVALRPEIYTSQEQADLLASAAAQLQRCQPSPAPSPLCQALGGAASPGLPPGKATHR
PCQQLSGPFSSAYDQVRKTRVAIKKISPFEHQTYCQRTLREIQILLRFRHENVIGIRDIL
RAPTLEGMRDVYIVQDLMETDLYKLLKSQHLSNDHICYFLYQILRGLKYIHSANVLHRDL
KPSNLLINTTCDLKICDFGLARIADPEHDHTGFLTEYVATRWYRAPEIMLNSKGYTKSID
IWSVGCILAEMLSNRPIFPGKHYLDQLNHILSILGSPSQEDLNCIINMKARNYLQSLPAK
TKVAWAKLFPKADPKALELLDRMLTFNPNKRITVEEALAHPYLEQYYDPTDEPVAEEPFT
FDMELDDLPKERLKELIFQETARFQPGAAEVP
NT seq 1359 nt   +upstreamnt  +downstreamnt
atggcccggctctgcctcctcctccccccgcaggtggcccagtgcacgcacaggcctctg
caggcagcccaccccctccccccaggtccccagccctacctgctgccagagatgacaatg
agcctccgagtggaggacgaagaagtggaggaggaggcgccccggctgggcctgcaccca
gggagcctggttgtcgccctgcgccccgaaatttacacaagccaggagcaggccgatctc
ctggcttcagcagccgcccagcttcaaaggtgccagccctctcctgctccctcccctctc
tgccaagccctgggtggggccgccagccctggactcccccctggtaaggccacacaccgt
ccatgtcaacagctctctggccctttcagctctgcctacgaccaagtgcgcaagactcgg
gtggccatcaagaagatcagccccttcgagcaccagacctactgccagcgcacgctgcgt
gagatccagatcttgctgcgcttccgccacgagaatgtcatcggcatccgagacattctg
cgggcacccaccctggaaggcatgagggatgtctacatcgtgcaggacctgatggagacc
gacctgtataagttgcttaagagccagcacctcagcaatgaccacatctgctacttcctc
taccagatcctgcggggcctcaagtacatccactcggccaacgtgctccaccgcgacctg
aagccctccaacctgctcatcaacaccacctgtgaccttaagatttgtgattttggcctg
gcccgcatcgccgaccctgagcacgaccacacgggcttcttgacagagtatgtggccacc
cgctggtaccgagcaccagagatcatgctcaactccaagggctacaccaaatccatcgac
atctggtctgtgggctgcatcctggctgagatgctctccaaccggcctatcttcccgggc
aagcactacctggaccagctgaaccacattctgagtattctgggctccccgtcccaggag
gacctgaattgtatcatcaacatgaaggcccggaattacctgcagtctttgccagccaag
accaaggttgcctgggccaagctttttcccaaggcagaccccaaagcccttgaactgctg
gatcggatgttgacctttaaccccaacaaacggatcacagtggaggaagcgttggcccac
ccctacctggagcagtactatgaccccacggatgagcccgtggctgaggagcccttcacc
ttcgacatggagctggatgacctccccaaggagcggctgaaggagctcattttccaagag
accgcacgcttccagcctggggccgcagaggtcccctag

DBGET integrated database retrieval system