Echinops telfairi (small Madagascar hedgehog): 101654289
Help
Entry
101654289 CDS
T08707
Symbol
PSMD7
Name
(RefSeq) 26S proteasome non-ATPase regulatory subunit 7
KO
K03038
26S proteasome regulatory subunit N8
Organism
etf
Echinops telfairi (small Madagascar hedgehog)
Pathway
etf03050
Proteasome
etf05010
Alzheimer disease
etf05012
Parkinson disease
etf05014
Amyotrophic lateral sclerosis
etf05016
Huntington disease
etf05017
Spinocerebellar ataxia
etf05020
Prion disease
etf05022
Pathways of neurodegeneration - multiple diseases
etf05169
Epstein-Barr virus infection
Brite
KEGG Orthology (KO) [BR:
etf00001
]
09120 Genetic Information Processing
09123 Folding, sorting and degradation
03050 Proteasome
101654289 (PSMD7)
09160 Human Diseases
09172 Infectious disease: viral
05169 Epstein-Barr virus infection
101654289 (PSMD7)
09164 Neurodegenerative disease
05010 Alzheimer disease
101654289 (PSMD7)
05012 Parkinson disease
101654289 (PSMD7)
05014 Amyotrophic lateral sclerosis
101654289 (PSMD7)
05016 Huntington disease
101654289 (PSMD7)
05017 Spinocerebellar ataxia
101654289 (PSMD7)
05020 Prion disease
101654289 (PSMD7)
05022 Pathways of neurodegeneration - multiple diseases
101654289 (PSMD7)
09180 Brite Hierarchies
09182 Protein families: genetic information processing
03051 Proteasome [BR:
etf03051
]
101654289 (PSMD7)
Proteasome [BR:
etf03051
]
Eukaryotic proteasome
Regulatory particles
PA700 (19S proteasome)
non-ATPase subunits
101654289 (PSMD7)
BRITE hierarchy
SSDB
Ortholog
Paralog
GFIT
Motif
Pfam:
MitMem_reg
JAB
Connexin
Coilin_N
Motif
Other DBs
NCBI-GeneID:
101654289
NCBI-ProteinID:
XP_004704633
LinkDB
All DBs
Position
Unknown
AA seq
324 aa
AA seq
DB search
MPELAVQKVVVHPLVLLSVVDHFNRIGKVGNQKRVVGVLLGSWQKKVLDVSNSFAVPFDE
DDKDDSVWFLDHDYLENMYGMFKKVNARERIVGWYHTGPKLHKNDIAINELMKRYCPNSV
LVIIDVKPKDLGLPTEAYISVEEVHDDGTPTSKTFEHVTSEIGAEEAEEVGVEHLLRDIK
DTTVGTLSQRITNQVHGLKGLNSKLLDIRSYLEKVATGKLPINHQIIYQLQDVFNLLPDV
SLQEFVKAFYLKTNDQMVVVYLASLIRSVVALHNLINNKIANRDAEKKEGQEKEESKKDR
KDDKEKDKDKEKSDVKKEEKKEKK
NT seq
975 nt
NT seq
+upstream
nt +downstream
nt
atgccggagctggcggtgcagaaggtggtcgtccaccccctggtgctgctcagtgtagtg
gatcacttcaatcggataggcaaggttggaaaccagaagcgtgttgttggtgtgcttttg
gggtcatggcaaaagaaagtactcgatgtatcaaacagttttgcagtcccattcgatgaa
gatgacaaagatgattctgtctggtttttagaccatgattatttagaaaacatgtatgga
atgtttaagaaggtcaatgctagagaaagaatagttggatggtaccacacaggccctaaa
ctacacaagaatgacattgccatcaatgaactcatgaaaagatactgccctaactcagta
ttggtcatcatcgacgtgaagcccaaggacttggggctgcccacagaagcgtatatctca
gtggaagaagttcatgatgatggaactccaacctcaaaaacatttgagcatgtaaccagt
gaaattggagcggaggaagcagaggaagttggagtggaacacttgttacgagacatcaaa
gacaccaccgtgggcacgctttcccagcgaatcacaaatcaggtccatggtttgaaggga
ctgaactccaagctcctggatatcaggagctacctggagaaagtggccacgggcaagctg
cccatcaaccaccagatcatctaccagctgcaggacgtcttcaacctactgccagacgtc
agcctgcaggagttcgtcaaggccttctacctgaagaccaacgaccagatggtggtggtg
tacctggcctcgctgatccggtctgtggtcgccctgcacaacctcatcaacaacaagatt
gccaaccgggatgcggagaagaaagaagggcaggaaaaggaagagagcaaaaaggatagg
aaagatgacaaggagaaagataaagacaaggaaaagagtgatgtaaagaaagaagagaaa
aaggagaaaaaatga
DBGET
integrated database retrieval system