KEGG   Empidonax traillii (willow flycatcher): 114056924
Entry
114056924         CDS       T05887                                 
Symbol
TNFRSF8
Name
(RefSeq) tumor necrosis factor receptor superfamily member 8
  KO
K05145  tumor necrosis factor receptor superfamily member 8
Organism
etl  Empidonax traillii (willow flycatcher)
Pathway
etl04060  Cytokine-cytokine receptor interaction
Brite
KEGG Orthology (KO) [BR:etl00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    114056924 (TNFRSF8)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04050 Cytokine receptors [BR:etl04050]
    114056924 (TNFRSF8)
   04090 CD molecules [BR:etl04090]
    114056924 (TNFRSF8)
Cytokine receptors [BR:etl04050]
 Tumor necrosis factor receptors
  TNF receptor superfamily
   114056924 (TNFRSF8)
CD molecules [BR:etl04090]
 Proteins
  114056924 (TNFRSF8)
SSDB
Motif
Pfam: TNFR_c6 Dsc3_C
Other DBs
NCBI-GeneID: 114056924
NCBI-ProteinID: XP_027738376
LinkDB
Position
Unknown
AA seq 481 aa
MAARSLAPALGLLLLLQDIQTSLQISLTCDTRGNWFYDETSQSCCYQCPSGSVNKKACPQ
DPSADCIRCGPGQYVNTENLRPRCDACVLCKESDLVEKEPCSFTSGRKCECRPGLFCQLN
HPYTCHRCQPHTPCQPGFGVQVRGNSTHDVTCEECPAGTFSDQSSSTDICRPHTDCAKLN
KVALSKGNATHDQVCLDQSPTYLTQSTLPTRLSHETNHSDLRRLEESLVTTASGDLPSAT
TTENPSSTPEEKALSGTFPTSAKGEMTMGGVVLWAVVLCVIVLLGAVLFFWKWKLCKKRI
LVLKGKPHLHSVIAHKYGLKSPGPDLGHRCAKILLSPESGPEEKELIDRTLPLETNNNLV
SSTEKAPSPPRGVAEVTPSSGNSPDCPVDSRVRDHTNNRIEKLYIMKADTVIVGSIAEVA
GGKNCPGRGCESNSDTQEIVEEELAMHYPEQETESFPGNDVMVPVEEEGKEFHHPTTATE
K
NT seq 1446 nt   +upstreamnt  +downstreamnt
atggctgcccgcagcctggcaccggcactggggctcctgctgcttctccaggacatccag
acatccctgcagatatcattaacctgtgacacacgtggaaattggttctatgatgaaact
tcacaaagctgctgttaccagtgtccctcaggctctgttaacaagaaagcttgtcctcag
gacccatctgcagactgcataaggtgtgggcctgggcaatatgtcaacacagaaaacctg
aggccacgatgtgatgcctgtgtcttatgcaaagaatcggatctggtggagaaggagccc
tgctccttcacctccggccgcaagtgcgagtgcaggccaggcctgttctgccagctcaac
cacccctacacctgccaccggtgccagccccacaccccctgccagcctggcttcggggtc
caagtcagaggcaactcaacacatgatgtcacttgtgaagagtgccctgctgggaccttc
tctgaccaaagctccagcactgacatctgcaggccccacacggactgtgccaagttaaac
aaggtggcactgagcaaaggaaatgccacacacgatcaggtttgcctggaccagtcgccc
acctacctcacccaaagcactttgcccacgagactcagccatgaaacaaatcactctgac
ctgaggaggcttgaggagagcctggtgaccactgctagtggagatcttccaagtgccact
acgactgaaaaccccagttcaactcctgaggagaaagctctgagtggcacttttcccacc
tcagccaagggggagatgacaatgggaggtgtggtgctctgggcagtggttctctgtgtg
attgtgctcctcggggccgtgctgttcttctggaagtggaagctttgcaagaagcggatc
ctggtcctcaaaggaaagccccatctgcattctgtcatcgcacacaaatacggcctcaaa
tcgccaggtcctgacctagggcacagatgtgcaaagatcctcctgagccctgagagtggg
ccagaagagaaggagttaattgacagaaccctccctttggaaaccaacaataacttggtc
tccagtacagaaaaagcaccgagtccccctcggggtgtggctgaggtgacacccagcagt
gggaacagcccagattgtcctgtggattctcgagtcagagaccacacaaacaacagaatt
gaaaagctctacatcatgaaggccgacactgttatcgtgggctccatcgcagaagtggcc
ggtggcaagaactgccctggcagaggatgtgaaagtaactctgacacccaggaaatcgtg
gaagaggaactggcaatgcactacccagagcaggaaacagagtcctttccagggaatgat
gtcatggttcccgtggaagaggagggaaaggagtttcaccaccccaccactgccacagag
aagtga

DBGET integrated database retrieval system