Empidonax traillii (willow flycatcher): 114057952 Help Entry 114057952         CDS       T05887                                  Name (RefSeq) histone H2A type 2-B   KO K11251   histone H2A Organism etl  Empidonax traillii (willow flycatcher) Pathway etl03082   ATP-dependent chromatin remodeling etl04217   Necroptosis Brite KEGG Orthology (KO) [BR:etl00001]  09120 Genetic Information Processing   09126 Chromosome    03082 ATP-dependent chromatin remodeling     114057952  09140 Cellular Processes   09143 Cell growth and death    04217 Necroptosis     114057952  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03036 Chromosome and associated proteins [BR:etl03036]     114057952   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:etl04147]     114057952 Chromosome and associated proteins [BR:etl03036]  Eukaryotic type   Nucleosome assembly factors    Histones     114057952 Exosome [BR:etl04147]  Exosomal proteins   Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)    114057952 BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  Histone_H2A_C Histone CBFD_NFYB_HMF Motif Other DBs NCBI-GeneID:  114057952 NCBI-ProteinID:  XP_027740607 LinkDB All DBs Position Unknown AA seq 126 aa AA seqDB search MSGRGKSGGKARAKAKSRSSRAGLQFPVGRVHRLLRKGNYAERVGAGAPVYLAAVLEYLS AEILELAGNAARDNKKTRIIPRHLQLAIRNDEELNKLLGGVTIAQGGVLPNIQAVLLPKK TQSSKK NT seq 381 nt NT seq  +upstreamnt  +downstreamnt atgtcgggccgggggaagtccggcgggaaggcgcgggccaaggccaagtcgcgctcgtcg cgggccgggctgcagtttcccgtggggagggtgcaccggctgctaaggaagggtaactac gcggagcgggtgggcgccggggcgccggtgtacctggcggcggtgctggagtacctgtcg gccgaaatcctggagctggcgggcaacgcggcccgcgacaacaagaagacgcgcatcatc ccgcggcacctgcagctcgccatccgcaacgacgaggagctcaacaagctgctgggcggc gtgaccatcgcccagggcggcgtcctgcccaacatccaggccgtgctgctgcccaagaag acgcagagctccaagaagtga

DBGET integrated database retrieval system