Empidonax traillii (willow flycatcher): 114062446 Help Entry 114062446         CDS       T05887                                  Name (RefSeq) histone H3-like   KO K11253   histone H3 Organism etl  Empidonax traillii (willow flycatcher) Brite KEGG Orthology (KO) [BR:etl00001]  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03036 Chromosome and associated proteins [BR:etl03036]     114062446   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:etl04147]     114062446 Chromosome and associated proteins [BR:etl03036]  Eukaryotic type   Nucleosome assembly factors    Histones     114062446 Exosome [BR:etl04147]  Exosomal proteins   Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)    114062446 BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  Histone CENP-T_C CENP-S CBFD_NFYB_HMF YebU_pre-PUA_dom TFIID-31kDa Motif Other DBs NCBI-GeneID:  114062446 NCBI-ProteinID:  XP_027749650 LinkDB All DBs Position Unknown AA seq 88 aa AA seqDB search LREIRRYQKSTELLIRKLPFQRLVREIAQDFKTDLRFQSSAVMALQEASEAYLVGLFEDT NLCAIHAKRVTIMPKDIQLARRIRGERA NT seq 267 nt NT seq  +upstreamnt  +downstreamnt ctgcgcgagatccggcgctaccagaagtcgacggagctgctgatccgcaagctgcccttc cagcgcctggtgcgcgagatcgcgcaggacttcaagaccgacctgcgcttccagagctcg gccgtcatggctctgcaggaggccagcgaggcctacctggtggggctcttcgaagacacc aacctgtgtgccatccacgccaagcgcgtcaccatcatgcccaaggacatccagctcgcc cgccgcatccgcggagagcgtgcttaa

DBGET integrated database retrieval system