Empidonax traillii (willow flycatcher): 114064402 Help Entry 114064402         CDS       T05887                                  Symbol NRAS Name (RefSeq) GTPase NRas   KO K07828   GTPase NRas Organism etl  Empidonax traillii (willow flycatcher) Pathway etl04010   MAPK signaling pathway etl04012   ErbB signaling pathway etl04068   FoxO signaling pathway etl04137   Mitophagy - animal etl04140   Autophagy - animal etl04150   mTOR signaling pathway etl04210   Apoptosis etl04218   Cellular senescence etl04370   VEGF signaling pathway etl04371   Apelin signaling pathway etl04540   Gap junction etl04625   C-type lectin receptor signaling pathway etl04810   Regulation of actin cytoskeleton etl04910   Insulin signaling pathway etl04912   GnRH signaling pathway etl04916   Melanogenesis Brite KEGG Orthology (KO) [BR:etl00001]  09130 Environmental Information Processing   09132 Signal transduction    04010 MAPK signaling pathway     114064402 (NRAS)    04012 ErbB signaling pathway     114064402 (NRAS)    04370 VEGF signaling pathway     114064402 (NRAS)    04371 Apelin signaling pathway     114064402 (NRAS)    04068 FoxO signaling pathway     114064402 (NRAS)    04150 mTOR signaling pathway     114064402 (NRAS)  09140 Cellular Processes   09141 Transport and catabolism    04140 Autophagy - animal     114064402 (NRAS)    04137 Mitophagy - animal     114064402 (NRAS)   09143 Cell growth and death    04210 Apoptosis     114064402 (NRAS)    04218 Cellular senescence     114064402 (NRAS)   09144 Cellular community - eukaryotes    04540 Gap junction     114064402 (NRAS)   09142 Cell motility    04810 Regulation of actin cytoskeleton     114064402 (NRAS)  09150 Organismal Systems   09151 Immune system    04625 C-type lectin receptor signaling pathway     114064402 (NRAS)   09152 Endocrine system    04910 Insulin signaling pathway     114064402 (NRAS)    04912 GnRH signaling pathway     114064402 (NRAS)    04916 Melanogenesis     114064402 (NRAS)  09180 Brite Hierarchies   09182 Protein families: genetic information processing    04131 Membrane trafficking [BR:etl04131]     114064402 (NRAS)   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:etl04147]     114064402 (NRAS)    04031 GTP-binding proteins [BR:etl04031]     114064402 (NRAS) Membrane trafficking [BR:etl04131]  Exocytosis   Small GTPases and associated proteins    Other small GTPases and associated proteins     114064402 (NRAS)  Endocytosis   Macropinocytosis    Ras GTPases     114064402 (NRAS) Exosome [BR:etl04147]  Exosomal proteins   Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)    114064402 (NRAS)   Exosomal proteins of other body fluids (saliva and urine)    114064402 (NRAS)   Exosomal proteins of breast cancer cells    114064402 (NRAS)   Exosomal proteins of colorectal cancer cells    114064402 (NRAS) GTP-binding proteins [BR:etl04031]  Small (monomeric) G-proteins   Ras Family    Ras [OT]     114064402 (NRAS) BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  Ras Roc GTP_EFTU Arf FeoB_N RsgA_GTPase MMR_HSR1 Motif Other DBs NCBI-GeneID:  114064402 NCBI-ProteinID:  XP_027753202 LinkDB All DBs Position Unknown AA seq 159 aa AA seqDB search MPVFVLQDSYRKQVVIDGETCLLDILDTAGQEEYSAMRDQYMRTGEGFLCVFAINNSKSF ADINLYREQIKRVKDSDDVPMVLVGNKCDLPTRTVDTKQAQELAKSYGIPFIETSAKTRQ GVEDAFYTLVREIRQYRMKKLNSSEDGNQGCMGLSCAVM NT seq 480 nt NT seq  +upstreamnt  +downstreamnt atgcccgtgtttgtcctgcaggactcgtaccgtaagcaggtggtgatcgacggcgagacg tgcctgctggacatcctggacacggcggggcaggaggagtacagtgccatgagggaccag tacatgaggactggggagggattcctctgtgtctttgccatcaacaacagcaaatccttc gctgatatcaacctttacagagaacagatcaagagagtgaaagattcggatgacgtgccc atggtgctggttgggaacaagtgtgacctgcccacgagaacagtggacacaaaacaggct caagaattagccaaaagctacggaatccccttcatagagacctctgcaaaaacgagacag ggcgtggaagatgcattttacacactggtgagagagatccggcagtaccggatgaagaag ctcaacagcagcgaggatgggaaccaaggctgcatgggactgtcctgtgctgtgatgtga

DBGET integrated database retrieval system