Empidonax traillii (willow flycatcher): 114065085 Help Entry 114065085         CDS       T05887                                  Symbol CALML4 Name (RefSeq) calmodulin-like protein 4   KO K02183   calmodulin Organism etl  Empidonax traillii (willow flycatcher) Pathway etl04020   Calcium signaling pathway etl04070   Phosphatidylinositol signaling system etl04114   Oocyte meiosis etl04218   Cellular senescence etl04261   Adrenergic signaling in cardiomyocytes etl04270   Vascular smooth muscle contraction etl04371   Apelin signaling pathway etl04625   C-type lectin receptor signaling pathway etl04744   Phototransduction etl04910   Insulin signaling pathway etl04912   GnRH signaling pathway etl04916   Melanogenesis Brite KEGG Orthology (KO) [BR:etl00001]  09130 Environmental Information Processing   09132 Signal transduction    04371 Apelin signaling pathway     114065085 (CALML4)    04020 Calcium signaling pathway     114065085 (CALML4)    04070 Phosphatidylinositol signaling system     114065085 (CALML4)  09140 Cellular Processes   09143 Cell growth and death    04114 Oocyte meiosis     114065085 (CALML4)    04218 Cellular senescence     114065085 (CALML4)  09150 Organismal Systems   09151 Immune system    04625 C-type lectin receptor signaling pathway     114065085 (CALML4)   09152 Endocrine system    04910 Insulin signaling pathway     114065085 (CALML4)    04912 GnRH signaling pathway     114065085 (CALML4)    04916 Melanogenesis     114065085 (CALML4)   09153 Circulatory system    04261 Adrenergic signaling in cardiomyocytes     114065085 (CALML4)    04270 Vascular smooth muscle contraction     114065085 (CALML4)   09157 Sensory system    04744 Phototransduction     114065085 (CALML4)  09180 Brite Hierarchies   09181 Protein families: metabolism    01009 Protein phosphatases and associated proteins [BR:etl01009]     114065085 (CALML4)   09182 Protein families: genetic information processing    04131 Membrane trafficking [BR:etl04131]     114065085 (CALML4)    03036 Chromosome and associated proteins [BR:etl03036]     114065085 (CALML4)   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:etl04147]     114065085 (CALML4) Protein phosphatases and associated proteins [BR:etl01009]  Protein serine/threonine phosphatases   Phosphoprotein phosphatases (PPPs)    Calcineurin (PPP3/ PP2B)     Regulatory subunits      114065085 (CALML4) Membrane trafficking [BR:etl04131]  Exocytosis   Small GTPases and associated proteins    Rab associated proteins     114065085 (CALML4) Chromosome and associated proteins [BR:etl03036]  Eukaryotic type   Centrosome formation proteins    Centrosome duplication proteins     Centriole replication proteins      114065085 (CALML4) Exosome [BR:etl04147]  Exosomal proteins   Exosomal proteins of colorectal cancer cells    114065085 (CALML4) SSDB OrthologParalogGFIT Motif Pfam:  EF-hand_7 EF-hand_9 EF-hand_6 EF-hand_1 EF-hand_8 AIF-1 CFAP251_C SAPC2_N GPHH EF-hand_11 EF_EFCAB10_C LisH_WDR26 Cmr2_hel_dom2 EAP30 Motif Other DBs NCBI-GeneID:  114065085 NCBI-ProteinID:  XP_027754491 LinkDB All DBs Position Unknown AA seq 153 aa AA seqDB search MAKFLSQDQINEFKECFSLYDKKQKGKIKASDLLAVMRCLGASPTPGEVQRHLHLHRIDR NAELDFSTFLNIMYRQMKQEEPEREILTALAMIDRQRRGVISVAELRAKLTRLGEKLSEE EVDDLLKEANIGPNGTIKYDEFVRIICLPTVDY NT seq 462 nt NT seq  +upstreamnt  +downstreamnt atggcaaagtttctgtcccaggatcaaattaatgagttcaaggaatgtttttccctgtac gacaagaaacaaaaagggaagataaaggcctcggacctgctggcagtgatgaggtgcctg ggagccagcccgaccccgggggaggtgcagagacacctccacctgcacaggatcgacagg aatgcagagctggatttctccaccttcctgaacatcatgtacaggcagatgaagcaggag gagcccgagagggaaatcctgacagcgctggccatgatcgacaggcagaggagaggagtc atctctgtggcagagctgagggcaaagctcaccaggctgggggagaagctttctgaggag gaagtggatgacctgctgaaagaagccaacattgggccaaatggaacaataaaatatgat gagttcgttcgcatcatttgcctccccacggtcgactactga

DBGET integrated database retrieval system