Empidonax traillii (willow flycatcher): 114068193 Help Entry 114068193         CDS       T05887                                  Name (RefSeq) fibroblast growth factor 18-like   KO K04358   fibroblast growth factor Organism etl  Empidonax traillii (willow flycatcher) Pathway etl04010   MAPK signaling pathway etl04020   Calcium signaling pathway etl04810   Regulation of actin cytoskeleton Brite KEGG Orthology (KO) [BR:etl00001]  09130 Environmental Information Processing   09132 Signal transduction    04010 MAPK signaling pathway     114068193    04020 Calcium signaling pathway     114068193  09140 Cellular Processes   09142 Cell motility    04810 Regulation of actin cytoskeleton     114068193  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    04052 Cytokines and neuropeptides [BR:etl04052]     114068193    00536 Glycosaminoglycan binding proteins [BR:etl00536]     114068193 Cytokines and neuropeptides [BR:etl04052]  Cytokines   Growth factors (RTK binding)    114068193 Glycosaminoglycan binding proteins [BR:etl00536]  Heparan sulfate / Heparin   Growth factors/receptors    114068193 BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  FGF Motif Other DBs NCBI-GeneID:  114068193 NCBI-ProteinID:  XP_027759913 LinkDB All DBs Position Unknown AA seq 118 aa AA seqDB search MYSLLSACTCLCLHFLLLCFQVQMFAAEENVDFRIHVENQTRARDDVSRKQLRLYQLYSR TSGKHIQVLGRRISAKGEDGDKYEMPRKEGRGQISGRGLLLSKQPPQVRQSEQPALAP NT seq 357 nt NT seq  +upstreamnt  +downstreamnt atgtattcactgctctcagcctgcacttgcctatgtttacatttcctgctgctgtgcttt caggtacagatgtttgctgccgaggagaatgtggattttcggatacacgtggagaaccag acgcgagcgagggacgatgtgagcaggaagcagcttcggctctatcagctctacagcagg acaagcgggaagcacatccaagtgctcggcaggaggatcagtgccaaaggagaagatgga gataaatatgaaatgcccagaaaagaagggagggggcagatctcaggccggggattgctc ctttccaagcagccaccacaagtacggcagagtgagcagccagccctggctccgtga

DBGET integrated database retrieval system