Empidonax traillii (willow flycatcher): 114068509 Help Entry 114068509         CDS       T05887                                  Symbol DYNLT1 Name (RefSeq) dynein light chain Tctex-type 1   KO K10420   dynein light chain Tctex-type 1/3 Organism etl  Empidonax traillii (willow flycatcher) Pathway etl04145   Phagocytosis etl04814   Motor proteins etl05132   Salmonella infection Brite KEGG Orthology (KO) [BR:etl00001]  09140 Cellular Processes   09141 Transport and catabolism    04145 Phagocytosis     114068509 (DYNLT1)   09142 Cell motility    04814 Motor proteins     114068509 (DYNLT1)  09160 Human Diseases   09171 Infectious disease: bacterial    05132 Salmonella infection     114068509 (DYNLT1)  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    03037 Cilium and associated proteins [BR:etl03037]     114068509 (DYNLT1)    04812 Cytoskeleton proteins [BR:etl04812]     114068509 (DYNLT1) Cilium and associated proteins [BR:etl03037]  Motile cilia and associated proteins   Dynein arm    114068509 (DYNLT1) Cytoskeleton proteins [BR:etl04812]  Eukaryotic cytoskeleton proteins   Microtubules    Tubulin-binding proteins     Dyneins      114068509 (DYNLT1) SSDB OrthologParalogGFIT Motif Pfam:  Tctex-1 Motif Other DBs NCBI-GeneID:  114068509 NCBI-ProteinID:  XP_027760487 LinkDB All DBs Position Unknown AA seq 113 aa AA seqDB search MDEFQSGEEASFVADEVSSIIKEAIEGAIGGNAYQHSKVNQWTTGVVEQTLSQLTKLGKP FKYIVTCVIMQKNGAGLHTASSCFWDNSSDGTCTVRWENKTMYCIVSAFGLAI NT seq 342 nt NT seq  +upstreamnt  +downstreamnt atggatgagttccagtcgggagaggaggcttcctttgttgctgatgaagtcagtagcatc attaaagaggccatagagggtgcgataggtggcaatgcctaccagcacagcaaggtgaac cagtggacaacaggagtggtggaacagacactgagccaactcacaaagctaggcaagccc ttcaagtacatcgtgacctgtgtgattatgcaaaagaatggtgctgggctacatacagca agctcttgcttctgggacaactccagtgatggaacctgcactgtgagatgggagaataag accatgtactgtattgtcagtgcctttggacttgcaatataa

DBGET integrated database retrieval system