Empidonax traillii (willow flycatcher): 114069811 Help Entry 114069811         CDS       T05887                                  Name (RefSeq) metallothionein-1   KO K14739   metallothionein 1/2 Organism etl  Empidonax traillii (willow flycatcher) Brite KEGG Orthology (KO) [BR:etl00001]  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03019 Messenger RNA biogenesis [BR:etl03019]     114069811    03029 Mitochondrial biogenesis [BR:etl03029]     114069811 Messenger RNA biogenesis [BR:etl03019]  Eukaryotic type   mRNA surveillance and transport factors    Factors involved in mRNA localization     Factors that have mRNA localization signals      114069811 Mitochondrial biogenesis [BR:etl03029]  Mitochondrial quality control factors   Regulator of mitochondrial biogenesis    Nuclear respiratory factors     114069811 BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  Metallothio Motif Other DBs NCBI-GeneID:  114069811 NCBI-ProteinID:  XP_027762661 LinkDB All DBs Position Unknown AA seq 63 aa AA seqDB search MDSQDCPCATGGTCTCGDNCKCKNCKCTSCKKGCCSCCPAGCAKCAQGCVCKGPPSAKCS CCK NT seq 192 nt NT seq  +upstreamnt  +downstreamnt atggactcccaggattgcccttgtgccacgggtggcacctgcacctgcggggacaactgc aaatgcaaaaactgcaaatgcacatcatgcaaaaaaggctgctgttcctgctgcccagca ggatgtgccaagtgtgcacagggctgtgtctgcaagggacccccctctgccaagtgcagc tgctgcaaatag

DBGET integrated database retrieval system