Empidonax traillii (willow flycatcher): 114070613 Help Entry 114070613         CDS       T05887                                  Name (RefSeq) interleukin-8-like   KO K10030   interleukin 8 Organism etl  Empidonax traillii (willow flycatcher) Pathway etl04060   Cytokine-cytokine receptor interaction etl04218   Cellular senescence etl04620   Toll-like receptor signaling pathway etl04621   NOD-like receptor signaling pathway etl04622   RIG-I-like receptor signaling pathway etl05132   Salmonella infection etl05164   Influenza A Brite KEGG Orthology (KO) [BR:etl00001]  09130 Environmental Information Processing   09133 Signaling molecules and interaction    04060 Cytokine-cytokine receptor interaction     114070613  09140 Cellular Processes   09143 Cell growth and death    04218 Cellular senescence     114070613  09150 Organismal Systems   09151 Immune system    04620 Toll-like receptor signaling pathway     114070613    04621 NOD-like receptor signaling pathway     114070613    04622 RIG-I-like receptor signaling pathway     114070613  09160 Human Diseases   09172 Infectious disease: viral    05164 Influenza A     114070613   09171 Infectious disease: bacterial    05132 Salmonella infection     114070613  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    04052 Cytokines and neuropeptides [BR:etl04052]     114070613    00536 Glycosaminoglycan binding proteins [BR:etl00536]     114070613 Cytokines and neuropeptides [BR:etl04052]  Cytokines   Chemokines    114070613 Glycosaminoglycan binding proteins [BR:etl00536]  Heparan sulfate / Heparin   Chemokines    114070613 BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  IL8 Motif Other DBs NCBI-GeneID:  114070613 NCBI-ProteinID:  XP_027763936 LinkDB All DBs Position Unknown AA seq 120 aa AA seqDB search MDGRSVAVALILYLVSMAGSEGKALGKTKEKGSSCECISTHSKFIPPKTVQDVRLSQRRP HCKNVEIIATLKDGREVCLEPTAPWIRLTVQALLARARDNTEPPVREKSRKNTLWNSSRI NT seq 363 nt NT seq  +upstreamnt  +downstreamnt atggatggcagatctgttgctgtcgctttgattctctatctggtctcaatggcagggtca gaaggtaaggccctggggaagaccaaggaaaaaggctccagttgtgagtgcataagcact cattccaagttcatccctcccaagacggttcaggatgtgagattaagccaaagaagacct cactgcaaaaatgtggaaatcatagctacactgaaagatggcagggaagtgtgtctggaa cccactgcgccctggatccggctcactgtacaggctctgctggccagggccagggacaat actgagccaccggtcagagagaagtcaaggaaaaatacactttggaattcttcaaggata tga

DBGET integrated database retrieval system