Empidonax traillii (willow flycatcher): 114072698 Help Entry 114072698         CDS       T05887                                  Name (RefSeq) histone H2B 1/2-like   KO K11252   histone H2B Organism etl  Empidonax traillii (willow flycatcher) Brite KEGG Orthology (KO) [BR:etl00001]  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03036 Chromosome and associated proteins [BR:etl03036]     114072698   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:etl04147]     114072698 Chromosome and associated proteins [BR:etl03036]  Eukaryotic type   Nucleosome assembly factors    Histones     114072698 Exosome [BR:etl04147]  Exosomal proteins   Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)    114072698 BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  Histone CBFD_NFYB_HMF TFIID_20kDa LonB_AAA-LID Motif Other DBs NCBI-GeneID:  114072698 NCBI-ProteinID:  XP_027766363 LinkDB All DBs Position Unknown AA seq 67 aa AA seqDB search MGIMNSFVNDIFERIAGEASRLAHYNKRSTITSREIQTAVRLLLPGELAKHAVSEGTKAV TKYTSSK NT seq 204 nt NT seq  +upstreamnt  +downstreamnt atgggcatcatgaactccttcgtcaacgacatcttcgagcgcatcgccggcgaggcgtct cgcctggcgcactacaacaagcgctccaccatcacgtcgcgggagatccagacggccgtg cggctgctgctgcccggcgagctggccaagcacgccgtctccgagggcaccaaggctgtc accaagtacaccagctccaagtaa

DBGET integrated database retrieval system