Empidonax traillii (willow flycatcher): 114072745 Help Entry 114072745         CDS       T05887                                  Name (RefSeq) thioredoxin   KO K03671   thioredoxin Organism etl  Empidonax traillii (willow flycatcher) Pathway etl04621   NOD-like receptor signaling pathway etl05132   Salmonella infection Brite KEGG Orthology (KO) [BR:etl00001]  09150 Organismal Systems   09151 Immune system    04621 NOD-like receptor signaling pathway     114072745  09160 Human Diseases   09171 Infectious disease: bacterial    05132 Salmonella infection     114072745  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03110 Chaperones and folding catalysts [BR:etl03110]     114072745 Chaperones and folding catalysts [BR:etl03110]  Protein folding catalysts   Protein disulfide isomerase    114072745 SSDB OrthologParalogGFIT Motif Pfam:  Thioredoxin Thioredoxin_2 Thioredoxin_8 AhpC-TSA DIM1 OST3_OST6 Glutaredoxin Thioredoxin_7 Thioredoxin_9 PedC-like Redoxin Motif Other DBs NCBI-GeneID:  114072745 NCBI-ProteinID:  XP_027766430 LinkDB All DBs Position Unknown AA seq 105 aa AA seqDB search MVKSVGSLTEFEAELKSAGEKLIVVDFSATWCGPCKMIKPFFHSLCEKYGDVVFIEIDVD DAQDVASHCDVKCMPTFQFYKNGKKVQEFSGANKEKLEETIKSLV NT seq 318 nt NT seq  +upstreamnt  +downstreamnt atggtgaagagcgtgggcagcctgaccgaatttgaggcggaactgaaatctgctggtgag aagcttattgtagttgatttctctgctacatggtgtggaccatgcaaaatgatcaagccc tttttccatagcttgtgtgagaagtatggcgatgtggtgttcatagaaattgatgtggat gatgcccaggatgttgcttcacactgcgatgtgaagtgcatgccaacgttccagttctac aagaatggaaagaaggtgcaggagttctctggggccaataaagagaagctggaagagacc attaaaagtcttgtctga

DBGET integrated database retrieval system