Empidonax traillii (willow flycatcher): 114073109 Help Entry 114073109         CDS       T05887                                  Name (RefSeq) claudin-20-like   KO K06087   claudin Organism etl  Empidonax traillii (willow flycatcher) Pathway etl03272   Virion - Hepatitis viruses etl04382   Cornified envelope formation etl04514   Cell adhesion molecules etl04530   Tight junction Brite KEGG Orthology (KO) [BR:etl00001]  09120 Genetic Information Processing   09125 Information processing in viruses    03272 Virion - Hepatitis viruses     114073109  09130 Environmental Information Processing   09133 Signaling molecules and interaction    04514 Cell adhesion molecules     114073109  09140 Cellular Processes   09144 Cellular community - eukaryotes    04530 Tight junction     114073109  09150 Organismal Systems   09158 Development and regeneration    04382 Cornified envelope formation     114073109  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    03037 Cilium and associated proteins [BR:etl03037]     114073109    04147 Exosome [BR:etl04147]     114073109    04515 Cell adhesion molecules [BR:etl04515]     114073109 Cilium and associated proteins [BR:etl03037]  Other cilia and associated proteins   Stereociliary proteins    114073109 Exosome [BR:etl04147]  Exosomal proteins   Exosomal proteins of ovarian cancer cells    114073109   Exosomal proteins of colorectal cancer cells    114073109 Cell adhesion molecules [BR:etl04515]  Immunoglobulin superfamily   L1 family    114073109 BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  PMP22_Claudin Claudin_2 Motif Other DBs NCBI-GeneID:  114073109 NCBI-ProteinID:  XP_027766699 LinkDB All DBs Position Unknown AA seq 164 aa AA seqDB search WYSTGMFSCTLKYSILSLPVYIQAARTTMVLSCILSAFGICITTVGMKCTKLGGDSDSKS HACFAGGICFVLAGICGLVPTSWYTREIISNFLDQTIPESSKHEPGAAVYTGFISAGFLL IAGVIFCTSCFNKQQGGWIYPPRQHHFPSAEQESNAGYNLKDYV NT seq 495 nt NT seq  +upstreamnt  +downstreamnt tggtacagcactgggatgtttagctgtaccctgaaatactccattctctctctccccgtc tacatccaggctgcacggaccaccatggtactgtcttgtatcctatcagcatttgggatc tgcatcactacagttggaatgaaatgcaccaagttgggaggggacagtgacagcaaaagt cacgcttgtttcgctggaggaatctgcttcgttcttgcaggaatctgtggattagtacca acatcctggtacacaagagaaattatttcaaattttctggaccagaccattccagagagc agtaaacatgaaccaggagcagcagtttatacaggattcatttcagcaggctttctgctt atcgcaggtgtgattttctgcacttcctgttttaacaagcagcaaggaggatggatttac cctccaaggcagcatcattttccatccgcagaacaggagagcaatgcaggttacaacctg aaggactatgtgtaa

DBGET integrated database retrieval system