Empidonax traillii (willow flycatcher): 114073173 Help Entry 114073173         CDS       T05887                                  Name (RefSeq) glutathione S-transferase-like   KO K00799   glutathione S-transferase [EC:2.5.1.18] Organism etl  Empidonax traillii (willow flycatcher) Pathway etl00480   Glutathione metabolism etl00980   Metabolism of xenobiotics by cytochrome P450 etl00982   Drug metabolism - cytochrome P450 etl00983   Drug metabolism - other enzymes etl01100   Metabolic pathways Brite KEGG Orthology (KO) [BR:etl00001]  09100 Metabolism   09106 Metabolism of other amino acids    00480 Glutathione metabolism     114073173   09111 Xenobiotics biodegradation and metabolism    00980 Metabolism of xenobiotics by cytochrome P450     114073173    00982 Drug metabolism - cytochrome P450     114073173    00983 Drug metabolism - other enzymes     114073173  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    02000 Transporters [BR:etl02000]     114073173 Enzymes [BR:etl01000]  2. Transferases   2.5  Transferring alkyl or aryl groups, other than methyl groups    2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)     2.5.1.18  glutathione transferase      114073173 Transporters [BR:etl02000]  Other transporters   Pores ion channels [TC:1]    114073173 BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  GST_C_3 GST_C GST_C_2 Motif Other DBs NCBI-GeneID:  114073173 NCBI-ProteinID:  XP_027766764 LinkDB All DBs Position Unknown AA seq 128 aa AA seqDB search MYVEGMFDLNELLMNYDFEPADKKEQLFANMMDKAANRYFPAFEKVLKDHGQDFLVGNQL SRADVQLLEILLMAEEFKPDILAKFPLLQRFKARISNIPTIKKFLQPGSQRKSPVRPEDV PKVLAIFS NT seq 387 nt NT seq  +upstreamnt  +downstreamnt atgtatgtggaaggaatgtttgatctgaatgagctactcatgaactatgatttcgaacca gcagataaaaaggagcaactttttgctaatatgatggacaaggccgcaaacagatacttc ccagcctttgagaaggttttgaaagaccatggacaagactttcttgttggcaaccagtta agcagggcagatgtgcagttacttgaaatccttttgatggcagaagagttcaagcctgat atacttgccaaatttcctctcttgcagcgttttaaagcaagaataagcaatatccccaca ataaagaaattcctgcagcctggcagccagaggaaatcaccagtgcgaccagaagatgta cccaaagtgctggcaattttctcctga

DBGET integrated database retrieval system