Emergencia timonensis: CE91St48_01510 Help Entry CE91St48_01510    CDS       T08071                                  Name (GenBank) hypothetical protein   KO K00176   2-oxoglutarate ferredoxin oxidoreductase subunit delta [EC:1.2.7.3] Organism etm  Emergencia timonensis Pathway etm00020   Citrate cycle (TCA cycle) etm00720   Other carbon fixation pathways etm01100   Metabolic pathways etm01110   Biosynthesis of secondary metabolites etm01120   Microbial metabolism in diverse environments etm01200   Carbon metabolism etm01210   2-Oxocarboxylic acid metabolism Brite KEGG Orthology (KO) [BR:etm00001]  09100 Metabolism   09101 Carbohydrate metabolism    00020 Citrate cycle (TCA cycle)     CE91St48_01510   09102 Energy metabolism    00720 Other carbon fixation pathways     CE91St48_01510 Enzymes [BR:etm01000]  1. Oxidoreductases   1.2  Acting on the aldehyde or oxo group of donors    1.2.7  With an iron-sulfur protein as acceptor     1.2.7.3  2-oxoglutarate synthase      CE91St48_01510 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Fer4 Fer4_10 Fer4_9 Fer4_7 Fer4_2 Fer4_16 Fer4_6 Fer4_21 Fer4_8 Fer4_17 Fer4_3 Fer4_4 Fer4_22 LdpA_Fe-S-bd Fer4_13 Fer4_15 Motif Other DBs NCBI-ProteinID:  BDF06710 LinkDB All DBs Position complement(166727..166927) Genome browser AA seq 66 aa AA seqDB search MANGKRLVVEPAWCKGCGYCVEFCPKKVLVLEHEKIVVKSPEACICCGLCEQRCPDYAIW VEKEAM NT seq 201 nt NT seq  +upstreamnt  +downstreamnt atggcgaatggtaaaagactcgtcgtggaacccgcatggtgcaaaggctgcggatactgc gtcgagttctgtccaaaaaaagtactggtattagagcatgaaaaaatagtggtgaagagc cccgaggcctgcatctgctgcggtctctgcgaacagcgctgtcctgactacgcgatctgg gtagaaaaggaggcgatgtaa

DBGET integrated database retrieval system