Winslowiella toletana: RIN69_00280 Help Entry RIN69_00280       CDS       T09410                                  Name (GenBank) acyl carrier protein   KO K02078   acyl carrier protein Organism eto  Winslowiella toletana Pathway eto01100   Metabolic pathways eto01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:eto00001]  09100 Metabolism   09103 Lipid metabolism    00061 Fatty acid biosynthesis     RIN69_00280    00074 Mycolic acid biosynthesis     RIN69_00280   09110 Biosynthesis of other secondary metabolites    00998 Biosynthesis of various antibiotics     RIN69_00280 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  PP-binding DUF7080 L_protein_N PaaA_PaaC Motif Other DBs NCBI-ProteinID:  WNN44392 LinkDB All DBs Position complement(60239..60493) Genome browser AA seq 84 aa AA seqDB search MPNYDEVYSKVCEMLCDAKDLEQEDLTPDMPLYQLKLDSLDYVELMVLAKKEFGVTIEAD LFVDNVNITVRELCQYLSEKATKP NT seq 255 nt NT seq  +upstreamnt  +downstreamnt atgccgaattatgatgaggtttacagcaaggtttgcgagatgctgtgtgacgcgaaggat cttgagcaggaagatctcaccccggacatgcccttgtatcagctcaaactcgatagcctg gattacgttgaactgatggtgctggcgaagaaagagtttggcgtcaccatcgaggctgat ttgttcgtcgataacgtgaacattacggtgcgtgagctgtgccagtatctcagcgaaaaa gccactaagccatga

DBGET integrated database retrieval system