Erwinia tracheiphila: LU633_10000 Help Entry LU633_10000       CDS       T07827                                  Symbol acpP Name (GenBank) acyl carrier protein   KO K02078   acyl carrier protein Organism etp  Erwinia tracheiphila Pathway etp01100   Metabolic pathways etp01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:etp00001]  09100 Metabolism   09103 Lipid metabolism    00061 Fatty acid biosynthesis     LU633_10000 (acpP)    00074 Mycolic acid biosynthesis     LU633_10000 (acpP)   09110 Biosynthesis of other secondary metabolites    00998 Biosynthesis of various antibiotics     LU633_10000 (acpP) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  PP-binding PP-binding_2 ACP_SdgA_C HLH TerB Ribosomal_L50 DUF1896 UGSC Motif Other DBs NCBI-ProteinID:  UIA98063 LinkDB All DBs Position 1898803..1899039 Genome browser AA seq 78 aa AA seqDB search MNTIEERVKKIIGEQLGVKQEEVVNAASFVEDLGADSLDTVELVMALEEEFDTEIPDEKA EKITTVQDAINYINDHQA NT seq 237 nt NT seq  +upstreamnt  +downstreamnt atgaacactatcgaagaacgtgttaagaaaatcattggtgagcagcttggcgttaagcag gaagaagttgtgaatgctgcctcttttgtagaagacctgggcgctgattctcttgatacc gttgagttggtcatggctctggaagaagagtttgacaccgagattccggacgaaaaagct gagaaaatcacaacagtccaggacgctattaattacatcaatgatcaccaggcataa

DBGET integrated database retrieval system