Edwardsiella piscicida EIB202: ETAE_0313 Help Entry ETAE_0313         CDS       T01121                                  Symbol groES Name (GenBank) co-chaperonin GroES (HSP10)   KO K04078   chaperonin GroES Organism etr  Edwardsiella piscicida EIB202 Brite KEGG Orthology (KO) [BR:etr00001]  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03110 Chaperones and folding catalysts [BR:etr03110]     ETAE_0313 (groES)    03029 Mitochondrial biogenesis [BR:etr03029]     ETAE_0313 (groES) Chaperones and folding catalysts [BR:etr03110]  Heat shock proteins   HSP10    ETAE_0313 (groES) Mitochondrial biogenesis [BR:etr03029]  Mitochondrial protein import machinery   Matrix    Other matrix factors     ETAE_0313 (groES) SSDB OrthologParalogGFIT Motif Pfam:  Cpn10 Rad9_Rad53_bind DUF7205 Motif Other DBs NCBI-ProteinID:  ACY83160 UniProt:  A0AAU8P1Z7 LinkDB All DBs Position 343264..343557 Genome browser AA seq 97 aa AA seqDB search MKIRPLHDRVIVKRKEVESKSAGGIVLTGSAAGKSTRGEVIAVGHGRILENGDVKPLDVK VGDTVIFNDGYGVKAEKIDNEEVLIMSESDILAIVEA NT seq 294 nt NT seq  +upstreamnt  +downstreamnt atgaaaattcgtccattgcatgaccgtgtgatcgtcaagcgcaaagaagttgagtccaag tctgctggcggcatcgttctgaccggttccgcagcgggcaaatccacgcgtggtgaagtc atcgccgtgggtcatggtcgcattctggagaatggcgacgtgaaaccgctggacgtgaag gtcggtgacaccgtgattttcaacgatggttatggcgtgaaagccgagaagatcgacaat gaagaagtgttgatcatgtccgaaagcgacattctggccatcgttgaggcgtaa

DBGET integrated database retrieval system