Edwardsiella piscicida EIB202: ETAE_0476 Help Entry ETAE_0476         CDS       T01121                                  Symbol holD Name (GenBank) DNA polymerase III, psi subunit   KO K02344   DNA polymerase III subunit psi [EC:2.7.7.7] Organism etr  Edwardsiella piscicida EIB202 Pathway etr03030   DNA replication etr03430   Mismatch repair etr03440   Homologous recombination Brite KEGG Orthology (KO) [BR:etr00001]  09120 Genetic Information Processing   09124 Replication and repair    03030 DNA replication     ETAE_0476 (holD)    03430 Mismatch repair     ETAE_0476 (holD)    03440 Homologous recombination     ETAE_0476 (holD)  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03032 DNA replication proteins [BR:etr03032]     ETAE_0476 (holD)    03400 DNA repair and recombination proteins [BR:etr03400]     ETAE_0476 (holD) Enzymes [BR:etr01000]  2. Transferases   2.7  Transferring phosphorus-containing groups    2.7.7  Nucleotidyltransferases     2.7.7.7  DNA-directed DNA polymerase      ETAE_0476 (holD) DNA replication proteins [BR:etr03032]  Prokaryotic type   DNA Replication Elongation Factors    Elongation factors (bacterial)     DNA polymerase III holoenzyme      ETAE_0476 (holD) DNA repair and recombination proteins [BR:etr03400]  Prokaryotic type   SSBR (single strand breaks repair)    MMR (mismatch excision repair)     DNA polymerase III holoenzyme      ETAE_0476 (holD) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  DNA_III_psi Motif Other DBs NCBI-ProteinID:  ACY83323 UniProt:  A0AAU8P171 LinkDB All DBs Position 524113..524523 Genome browser AA seq 136 aa AA seqDB search MTSRRDQLLQQLGITQWVLRRPALLRGEVAITLSAQTRLLIVSEAPLSPDDLLLCDILRA LSLTAEQAVILTPEQYEMLSDRQRYLCWWLGESASSEACLRSPALGALYHNPGAKRALWQ QICHEQHHFFPDPGGH NT seq 411 nt NT seq  +upstreamnt  +downstreamnt atgacttcgcgacgcgatcaacttttacagcagctggggataacccaatgggtcctgcgt cgcccggcgcttctgcgcggcgaggtcgccattacgctgtcggcgcagacacggctgctt atcgtgtctgaggctcccctgtcgccggatgatctgttactgtgcgatattctacgcgcg ctgtcgctgacggcggagcaggcggtgatcctgacgccggagcagtatgagatgctcagc gatcgccagcgttacctgtgttggtggctgggggagtccgcctcctctgaggcttgcctc cgctctccggcgctcggtgcgctttaccataaccccggcgccaagcgcgccctgtggcag caaatttgtcatgagcaacatcatttcttccctgaccccggcggacactga

DBGET integrated database retrieval system