KEGG   Escherichia coli O157 H7 TW14359 (EHEC): ECSP_1712
Entry
ECSP_1712         CDS       T00949                                 
Symbol
espM1
Name
(GenBank) non-LEE-encoded type III secreted effector
  KO
K23653  T3SS effector EspM
Organism
etw  Escherichia coli O157:H7 TW14359 (EHEC)
Pathway
etw05130  Pathogenic Escherichia coli infection
Brite
KEGG Orthology (KO) [BR:etw00001]
 09160 Human Diseases
  09171 Infectious disease: bacterial
   05130 Pathogenic Escherichia coli infection
    ECSP_1712 (espM1)
SSDB
Motif
Pfam: IpaB_EvcA Potyvirid-P3
Other DBs
NCBI-ProteinID: ACT71547
LinkDB
Position
1732243..1732833
AA seq 196 aa
MPVNATGVSFSSFGISYHKDNSFRGTIRGKNDEVVKCSMGERSIRFNVNKFSGCILETVS
RQSTKDIHGWVSDERTVYPSRVINQEIDNCCLQKNAKISSEERKMVFSLVSKEFELTLDV
KAAQSSINHIIIGNASFGKKMDALCDGMSRAVKNSTTDYIANVLADKFYQKHIAPGVDIV
KLRNEIPGYMSRVIQG
NT seq 591 nt   +upstreamnt  +downstreamnt
atgccagtaaatgcgacaggtgtgtccttcagctcttttggtatcagttatcataaagat
aattctttccggggcaccatccgtgggaagaatgatgaggtcgtgaagtgttcaatggga
gagcgctctatccgctttaatgttaacaaatttagcggctgtatactggagacggtaagc
aggcagagtactaaagatattcatggatgggtaagtgatgaacggacagtatatccgtca
agggttatcaaccaagagattgataattgctgccttcaaaaaaatgcaaaaatttcttct
gaagagaggaaaatggtcttttctcttgtaagtaaggagtttgaactaactcttgatgtt
aaagcggcacaaagttctattaatcatataataataggaaatgcttcttttggcaaaaaa
atggatgctctttgcgatggtatgagccgagctgtaaaaaacagtacaacagattacata
gcaaacgtgcttgcagacaagttttatcagaaacatatcgccccgggtgttgatattgta
aaactacgaaatgaaatcccaggttatatgagtcgtgttatacaggggtaa

DBGET integrated database retrieval system