Escherichia coli O157 H7 TW14359 (EHEC): ECSP_2932 Help Entry ECSP_2932         CDS       T00949                                  Name (GenBank) hypothetical protein   KO K12149   DNA-damage-inducible protein I Organism etw  Escherichia coli O157:H7 TW14359 (EHEC) Brite KEGG Orthology (KO) [BR:etw00001]  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03400 DNA repair and recombination proteins [BR:etw03400]     ECSP_2932 DNA repair and recombination proteins [BR:etw03400]  Prokaryotic type   TLS (translesion DNA synthesis) factors    Other SOS response factors     ECSP_2932 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  DinI MAPKK1_Int Motif Other DBs NCBI-ProteinID:  ACT72718 LinkDB All DBs Position 2891943..2892191 Genome browser AA seq 82 aa AA seqDB search MRVEICIAKEKITKMPNGAVDALKEELTRRISKRYDDVEVIVKATSNDGLSVTRTADKDS AKTFVQETLKDTWESADEWFVR NT seq 249 nt NT seq  +upstreamnt  +downstreamnt atgcgtgttgagatctgtatcgctaaagaaaaaatcactaaaatgccaaacggtgctgtg gatgcgttaaaggaagaattaacccgacgcatcagtaaacgttatgacgatgtagaggtg atcgtaaaagccaccagcaacgatggcctttctgttacgcgcaccgccgataaagattca gctaaaacttttgttcaggagacgctgaaagatacctgggagtctgctgacgagtggttt gttcgctaa

DBGET integrated database retrieval system