Escherichia coli O157 H7 TW14359 (EHEC): ECSP_4435 Help Entry ECSP_4435         CDS       T00949                                  Name (GenBank) putative acyl carrier protein   KO K02078   acyl carrier protein Organism etw  Escherichia coli O157:H7 TW14359 (EHEC) Pathway etw01100   Metabolic pathways etw01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:etw00001]  09100 Metabolism   09103 Lipid metabolism    00061 Fatty acid biosynthesis     ECSP_4435   09110 Biosynthesis of other secondary metabolites    00998 Biosynthesis of various antibiotics     ECSP_4435 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  PP-binding Motif Other DBs NCBI-ProteinID:  ACT74160 LinkDB All DBs Position 4394734..4394991 Genome browser AA seq 85 aa AA seqDB search MQALYLEIKNLIISTLNLDELTPDDIDTDAPLFGDGLGLDSIDALELGLAVKNEYGIVLS AESEEMRQHFFSVATLASFIAAQRA NT seq 258 nt NT seq  +upstreamnt  +downstreamnt atgcaagcgctttatctggaaattaaaaacctcatcatcagcaccctcaatctggacgag ttgacgcctgatgatatcgataccgacgcgccgctgtttggcgacggtttagggctggac tctatcgatgccctggaactgggactggcagtaaaaaatgagtacggcatcgtgctctct gcggaaagcgaagagatgcgtcagcactttttctccgtcgccactctggcctctttcatt gctgcgcaacgtgcctga

DBGET integrated database retrieval system