KEGG   Escherichia coli O17 K52 H18 UMN026 (ExPEC): ECUMN_2376
Entry
ECUMN_2376        CDS       T00831                                 

Gene name
wbaD
Definition
(GenBank) Mannosyl transferase wbaD
  KO
K23202  O17/O44/073/077/0106-antigen biosynthesis mannosyltransferase
Organism
eum  Escherichia coli O17:K52:H18 UMN026 (ExPEC)
Pathway
eum00542  O-Antigen repeat unit biosynthesis
Brite
KEGG Orthology (KO) [BR:eum00001]
 09100 Metabolism
  09107 Glycan biosynthesis and metabolism
   00542 O-Antigen repeat unit biosynthesis
    ECUMN_2376 (wbaD)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01005 Lipopolysaccharide biosynthesis proteins [BR:eum01005]
    ECUMN_2376 (wbaD)
Lipopolysaccharide biosynthesis proteins [BR:eum01005]
 O-antigen repeat unit
  ECUMN_2376 (wbaD)
SSDB
Motif
Pfam: Glyco_trans_1_4 Glyco_trans_1_2 Glycos_transf_1
Other DBs
NCBI-ProteinID: CAR13564
UniProt: B7NC74
LinkDB
Position
complement(2409561..2410763)
AA seq 400 aa
MSNIDINKKQILVLTPRFPFPVIGGDRLRIYKICKELSKHYDLTLLSLCDKREELNYEYD
REVFSSVHRVYLSKKKSILNVIFSLFSNTPLQIGYYKSKEFEDKLKQLLPEHSATLSHLI
RVGDYVKENKDINFLEMTDAISLNYKRVKEKASLLSLKTFVYSFEQKRLERYERTINNKF
SLTTLVSQVDSDYLYPDRPNNVLVCGNGVDAVSLPFSERKIAKDKKITLVFIGNLYSLQN
MDGVRWFTKEVLPFLNKHGNFEFKVIGRITDKDKSWLESQPGVVVTGEVDSITYAAADGH
IGVCPIRLGAGIQNKVLEYMALGLPCISSTVGFEGLGAEEGKEIYVANTKEEYLRVLNYF
ITNLDKYTETALVAKKFIGENFSWEAKLSPYIQKIKESVK
NT seq 1203 nt   +upstreamnt  +downstreamnt
atgagtaatattgatataaataagaaacagatattagttttgactccacggttcccgttt
cctgtcattggtggggatcgattacgtatctataagatctgtaaagaactgtctaagcat
tatgatcttacgttgctgagtctgtgtgataaacgcgaagagctcaactatgaatatgat
cgtgaagtttttagtagtgttcacagagtatatctttcaaagaaaaaatctattttaaat
gtcatattctctttgttttcaaatactcccctacagattgggtattataaatctaaagaa
tttgaagataaacttaagcagttattacctgaacattctgcaactctttcacatttgata
agggttggtgattatgtgaaagagaataaagatataaattttttagagatgaccgatgcc
atttcacttaattataaacgagtaaaggaaaaagcatctttattgagtttaaaaacattt
gtatattcttttgaacaaaaaagactcgaacgatatgagcgaactataaataacaagttc
agcttgactactttggtatcacaggttgactccgattatttatatccagaccgtccgaat
aatgtattagtctgtggaaatggtgttgatgccgttagcttacctttttcagaacgaaaa
atagctaaagataaaaagataacccttgtatttataggtaatttatattctttgcaaaat
atggatggtgtgagatggttcaccaaggaagttttaccatttcttaacaagcatggtaat
tttgaatttaaggtcatcggacgtattacagataaagataagagttggttagaaagccag
cctggcgttgttgtcacaggtgaagttgatagcataacttatgcagcagctgatgggcat
attggtgtatgtcctattagattaggggcaggtatccaaaataaggtacttgaatatatg
gcgttgggattaccttgtatctcttctactgtaggctttgaaggcttgggagcagaggag
ggtaaggagatttatgttgccaatacaaaagaagaatatttacgtgtattaaattatttt
ataacaaatctggataaatataccgaaacagcattagttgcgaaaaagtttatcggtgag
aatttttcatgggaagctaaattgagcccatatatccagaaaattaaggagtctgttaaa
taa

DBGET integrated database retrieval system