Escherichia coli UMNK88 (ETEC, porcine): UMNK88_3734 Help Entry UMNK88_3734       CDS       T02001                                  Name (GenBank) conserved hypothetical protein   KO K02078   acyl carrier protein Organism eun  Escherichia coli UMNK88 (ETEC, porcine) Pathway eun01100   Metabolic pathways eun01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:eun00001]  09100 Metabolism   09103 Lipid metabolism    00061 Fatty acid biosynthesis     UMNK88_3734    00074 Mycolic acid biosynthesis     UMNK88_3734   09110 Biosynthesis of other secondary metabolites    00998 Biosynthesis of various antibiotics     UMNK88_3734 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  PP-binding DUF1493 BH4 Motif Other DBs NCBI-ProteinID:  AEE58270 LinkDB All DBs Position 3613607..3613855 Genome browser AA seq 82 aa AA seqDB search MVNREIVMDYILSCLQDLVENGVEIKPDSDLVNDLGLESIKVMDLLMMLEDRFDISIPIN ILLDVKTPAQLMETLLPWLENK NT seq 249 nt NT seq  +upstreamnt  +downstreamnt atggtaaatcgtgaaatagtaatggattacatcctttcctgtttacaggatttggtcgaa aacggtgtggaaattaagcccgacagcgatctcgtcaacgatcttggcctggagtcgatc aaagtgatggatctcttaatgatgctggaagacagattcgatatttccattcctattaat attctgctggatgtcaaaacccctgcgcaattaatggaaactctacttccatggctggag aataaataa

DBGET integrated database retrieval system