Escherichia coli UMNK88 (ETEC, porcine): UMNK88_pIncI119 Help Entry UMNK88_pIncI119   CDS       T02001                                  Name (GenBank) conserved hypothetical protein   KO K12149   DNA-damage-inducible protein I Organism eun  Escherichia coli UMNK88 (ETEC, porcine) Brite KEGG Orthology (KO) [BR:eun00001]  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03400 DNA repair and recombination proteins [BR:eun03400]     UMNK88_pIncI119 DNA repair and recombination proteins [BR:eun03400]  Prokaryotic type   TLS (translesion DNA synthesis) factors    Other SOS response factors     UMNK88_pIncI119 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  DinI RWD Motif Other DBs NCBI-ProteinID:  AEE59890 LinkDB All DBs Position pUMNK88_91:complement(16420..16668) Genome browser AA seq 82 aa AA seqDB search MIRIEILFDRQSTKNLKSGTLQALQNEIEQRLKPHYPEIWLRIDQGSAPSVSVTGARNDK DKERIMSLLEEIWQDDSWLPAA NT seq 249 nt NT seq  +upstreamnt  +downstreamnt atgatccgcattgaaattcttttcgaccgccagagcacaaaaaacctcaaatcaggcaca cttcaggcgctacagaatgaaatcgaacaacgtctgaaaccacactacccggaaatctgg ctgcgtatagaccagggcagcgccccgtctgtatctgtcacaggagcccgcaacgacaag gataaagaacgtatcatgtctctgctggaagaaatctggcaggacgacagctggctgcct gcagcatga

DBGET integrated database retrieval system