KEGG   Eutrema salsugineum (saltwater cress): EUTSA_v10004064mg
Entry
EUTSA_v10004064mg CDS       T02985                                 
Name
(RefSeq) hypothetical protein
  KO
K11818  aromatic aldoxime N-monooxygenase [EC:1.14.14.45]
Organism
eus  Eutrema salsugineum (saltwater cress)
Pathway
eus00380  Tryptophan metabolism
eus00966  Glucosinolate biosynthesis
eus01100  Metabolic pathways
eus01110  Biosynthesis of secondary metabolites
eus01210  2-Oxocarboxylic acid metabolism
Module
eus_M00370  Glucosinolate biosynthesis, tryptophan => glucobrassicin
Brite
KEGG Orthology (KO) [BR:eus00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00380 Tryptophan metabolism
    EUTSA_v10004064mg
  09110 Biosynthesis of other secondary metabolites
   00966 Glucosinolate biosynthesis
    EUTSA_v10004064mg
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   00199 Cytochrome P450 [BR:eus00199]
    EUTSA_v10004064mg
Enzymes [BR:eus01000]
 1. Oxidoreductases
  1.14  Acting on paired donors, with incorporation or reduction of molecular oxygen
   1.14.14  With reduced flavin or flavoprotein as one donor, and incorporation of one atom of oxygen into the other donor
    1.14.14.45  aromatic aldoxime N-monooxygenase
     EUTSA_v10004064mg
Cytochrome P450 [BR:eus00199]
 Cytochrome P450, plant type
  CYP83 family
   EUTSA_v10004064mg
SSDB
Motif
Pfam: p450 Transposase_31 Goodbye FANCI_S2
Other DBs
NCBI-GeneID: 18011561
NCBI-ProteinID: XP_006396006
UniProt: V4KTD4
LinkDB
Position
Unknown
AA seq 499 aa
MDLFLIIAALIAAAAFFLLQSSTKKSLRLPPGPKGLPIIGNLHQMEKFNPQHFLFRLSKL
YGPIFTMKIGGRRLAVISSAKLAKELLKTQDLNFTSRPLLKGQQTMSYQGRELGFGQYTA
YYREMRKMCMVNLFSPNRVASFRPVREEECQRMMDKIYTAADQSGTVDLSELLLSFTNCV
VCRQAFGKRYNEYGTEMKRFINILYETQALLGTLFFSDLFPYFGFLDTLTGLSSRLKRAF
KELDTYLQELLDETLDPNRPKPETESFIDLLMQIYKDQPFSIKFTHENVKAMILDIVVPG
TDTAAAVVVWAMTYLIKYPEAMKKAQDEVRNVVGRNGYVSEEDIPNLPYLKAVIKEALRL
EPVIPILLHRETIADAKIGGYDIPAKTIIQVNAWAVSRDTAAWGDNPDEFIPERFMNEHK
GVDFKGQDFELLPFGSGRRMCPAMHLGVAMVEIPFANLLYRFDWSLPKGIKPEDIKMDVM
TGLAMHKKDHLILAPRTHI
NT seq 1500 nt   +upstreamnt  +downstreamnt
atggatctcttcttgattattgccgccctgatagcggctgcagccttcttcctcctccag
agctccaccaagaaatctctccggttgcctccggggccaaaaggtcttcctattattgga
aacctccaccagatggagaaatttaatccacaacacttccttttccgtctctccaagctc
tacggtccaattttcacaatgaaaatcggaggccgtcgcctggcggtgatctcctcggct
aagctagcgaaggagctcctcaaaacacaagaccttaatttcacctctcgtcctctcctg
aaagggcaacaaactatgtcgtatcaaggccgtgagctgggtttcggacagtacacagcg
tactaccgtgagatgaggaagatgtgtatggtgaacctattcagcccaaaccgagtcgca
agtttccgacccgttagagaagaagagtgccaacgaatgatggacaagatctacacagcc
gctgaccaatcagggaccgttgatctaagtgagcttctcttgtccttcaccaactgtgtc
gtctgtagacaagcttttgggaagcgctataacgagtacggaacagagatgaagagattc
ataaacatcttgtacgagactcaagcccttttgggcactctgtttttctccgaccttttc
ccttatttcggattccttgacacactcactggtctcagttcgcgtctcaagagagctttc
aaggaactcgacacttaccttcaagaactccttgacgaaactcttgaccctaaccgccct
aaacccgagacagagagtttcattgatcttttgatgcagatctacaaagatcaacctttc
tccatcaaattcactcacgaaaatgtcaaggccatgatattggatattgttgtaccggga
actgacacggcagctgcggtggtggtatgggccatgacgtaccttataaagtaccctgaa
gcaatgaagaaagctcaagatgaagtgagaaatgtggtaggcaggaacggttatgtctcg
gaagaagacatacctaatctcccttatctgaaggccgtcataaaggaggctctccgtctc
gaaccagtcatccccattcttctacatagagaaaccattgcagacgcaaagatcggtggc
tatgatattccagcgaagaccatcattcaggtgaatgcgtgggcagtttctcgtgacaca
gccgcctggggagacaaccctgatgagttcattccagagaggttcatgaacgagcacaaa
ggagtagacttcaaggggcaagattttgagctcctacctttcgggtcgggacggagaatg
tgccccgcaatgcatcttggagtcgccatggttgagataccttttgctaacctcctctac
agatttgactggagcctaccaaaaggaatcaaaccagaggacataaagatggacgtcatg
acgggacttgctatgcataagaaagaccacctcatccttgcaccaaggacgcacatttga

DBGET integrated database retrieval system