Eutrema salsugineum (saltwater cress): EUTSA_v10006343mg Help Entry EUTSA_v10006343mg CDS       T02985                                  Name (RefSeq) hypothetical protein   KO K09481   protein transport protein SEC61 subunit beta Organism eus  Eutrema salsugineum (saltwater cress) Pathway eus03060   Protein export eus04141   Protein processing in endoplasmic reticulum eus04145   Phagosome Brite KEGG Orthology (KO) [BR:eus00001]  09120 Genetic Information Processing   09123 Folding, sorting and degradation    03060 Protein export     EUTSA_v10006343mg    04141 Protein processing in endoplasmic reticulum     EUTSA_v10006343mg  09140 Cellular Processes   09141 Transport and catabolism    04145 Phagosome     EUTSA_v10006343mg  09180 Brite Hierarchies   09182 Protein families: genetic information processing    04131 Membrane trafficking [BR:eus04131]     EUTSA_v10006343mg   09183 Protein families: signaling and cellular processes    02044 Secretion system [BR:eus02044]     EUTSA_v10006343mg Membrane trafficking [BR:eus04131]  Endoplasmic reticulum (ER) - Golgi transport   Others    SEC61 complex     EUTSA_v10006343mg Secretion system [BR:eus02044]  Sec (secretion) system   Eukaryotic Sec-SRP protein    EUTSA_v10006343mg BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  Sec61_beta Motif Other DBs NCBI-GeneID:  18019995 NCBI-ProteinID:  XP_006402571 UniProt:  V4LJZ5 LinkDB All DBs Position Unknown AA seq 85 aa AA seqDB search MVGGGAPQRGSAAATASMRRRKGGSSSSTGGGASGGAAGSMLQFYTDDAPGLKISPNVVL IMSIGFIAFVAVLHVMGKLYFVKSK NT seq 258 nt NT seq  +upstreamnt  +downstreamnt atggttggtggtggagctccgcagagaggaagtgcagctgcaactgcaagcatgcggagg aggaagggcggcagcagcagcagcaccggtggtggagcatccggaggagcagccggatca atgcttcagttctacacagacgacgcacctggtctcaagatttctccgaatgttgttctt attatgagcattggtttcattgctttcgttgctgttcttcatgtcatgggcaagctctac tttgtcaagagcaaatga

DBGET integrated database retrieval system