Eutrema salsugineum (saltwater cress): EUTSA_v10012363mg Help Entry EUTSA_v10012363mg CDS       T02985                                  Name (RefSeq) hypothetical protein   KO K03094   S-phase kinase-associated protein 1 Organism eus  Eutrema salsugineum (saltwater cress) Pathway eus03083   Polycomb repressive complex eus04120   Ubiquitin mediated proteolysis eus04141   Protein processing in endoplasmic reticulum Brite KEGG Orthology (KO) [BR:eus00001]  09120 Genetic Information Processing   09123 Folding, sorting and degradation    04141 Protein processing in endoplasmic reticulum     EUTSA_v10012363mg    04120 Ubiquitin mediated proteolysis     EUTSA_v10012363mg   09126 Chromosome    03083 Polycomb repressive complex     EUTSA_v10012363mg  09180 Brite Hierarchies   09182 Protein families: genetic information processing    04131 Membrane trafficking [BR:eus04131]     EUTSA_v10012363mg    04121 Ubiquitin system [BR:eus04121]     EUTSA_v10012363mg    03036 Chromosome and associated proteins [BR:eus03036]     EUTSA_v10012363mg Membrane trafficking [BR:eus04131]  Endosome - Lysosome transport   Acidification regulators    RAVE complex     EUTSA_v10012363mg Ubiquitin system [BR:eus04121]  Ubiquitin ligases (E3)   Multi subunit type E3    SCF complex     Adaptor protein      EUTSA_v10012363mg    Cul7 complex      EUTSA_v10012363mg Chromosome and associated proteins [BR:eus03036]  Eukaryotic type   Histone modification proteins    Polycomb repressive complex (PRC) and associated proteins     Noncanonical PRC1 (PRC1.1)      EUTSA_v10012363mg   Centromeric chromatin formation proteins    Kinetochore proteins     CBF3 complex      EUTSA_v10012363mg BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  Skp1_POZ Skp1 Methyltransf_19 Motif Other DBs NCBI-GeneID:  18011485 NCBI-ProteinID:  XP_006393345 UniProt:  V4MH51 LinkDB All DBs Position Unknown AA seq 103 aa AA seqDB search MSEKKIVLKSSDGKTIDVAKAVALQSQTITHMVEDSCVGNEIPFENVTGQVLAKVIEYCK KHVVVDGETLTCKTVAHVIHTRTIDEIRTFFNVENDYTPRKKQ NT seq 309 nt NT seq  +upstreamnt  +downstreamnt atgtcggagaagaagattgtgttgaagagctcagatggcaagaccattgatgttgcaaag gcggtggctctccagtcgcagaccataactcacatggttgaagatagctgtgtcggtaac gaaatccctttcgaaaatgtcaccggccaggtcctcgccaaagtgatcgagtattgcaag aaacacgtcgtcgtcgatggtgagactctcacttgcaaaacagttgctcatgtgatccat accagaactattgatgagattcgcactttttttaacgtcgagaacgattacacaccaagg aagaagcag

DBGET integrated database retrieval system