Eutrema salsugineum (saltwater cress): EUTSA_v10014822mg Help Entry EUTSA_v10014822mg CDS       T02985                                  Name (RefSeq) hypothetical protein   KO K03015   DNA-directed RNA polymerase II subunit RPB7 Organism eus  Eutrema salsugineum (saltwater cress) Pathway eus03020   RNA polymerase eus03420   Nucleotide excision repair Brite KEGG Orthology (KO) [BR:eus00001]  09120 Genetic Information Processing   09121 Transcription    03020 RNA polymerase     EUTSA_v10014822mg   09124 Replication and repair    03420 Nucleotide excision repair     EUTSA_v10014822mg  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03021 Transcription machinery [BR:eus03021]     EUTSA_v10014822mg    03019 Messenger RNA biogenesis [BR:eus03019]     EUTSA_v10014822mg    03400 DNA repair and recombination proteins [BR:eus03400]     EUTSA_v10014822mg Transcription machinery [BR:eus03021]  Eukaryotic type   RNA polymerase II system    RNA polymerase II     Pol II specific subunits      EUTSA_v10014822mg Messenger RNA biogenesis [BR:eus03019]  Eukaryotic type   mRNA surveillance and transport factors    mRNA cycle factors     P-body specific factors      EUTSA_v10014822mg DNA repair and recombination proteins [BR:eus03400]  Eukaryotic type   SSBR (single strand breaks repair)    NER (nucleotide excision repair)     TCR (transcription coupled repair) factors      DNA-directed RNA polymerase II complex       EUTSA_v10014822mg BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  SHS2_Rpb7-N S1 Motif Other DBs NCBI-GeneID:  18017976 NCBI-ProteinID:  XP_006400997 UniProt:  V4KWR9 LinkDB All DBs Position Unknown AA seq 140 aa AA seqDB search MFFHIVLERNMQLHPRFFGRNLRENLVSKLMKDVEGTCSGRHGFVVAITGIESVGKGLIR DGTGFVTFPVKYQCVVFRPFKGEILEAVVTLVNKMGFFAEAGPVQIFVSKHLIPDDMEFQ AGDMPHYTTSDGSVCFFLNL NT seq 423 nt NT seq  +upstreamnt  +downstreamnt atgttcttccacatagtattggagcggaacatgcagttgcatccacgattctttggtcga aaccttcgtgaaaatctcgtctctaagctcatgaaagatgtcgagggcacttgcagtggc cgacatgggtttgtagtggcgataactggaatagaaagcgtaggaaaaggattgatccga gatgggactggttttgtcacatttccagttaaataccaatgcgtcgtttttagacctttc aaaggcgagattttagaagctgttgtcactttggtcaataagatgggtttcttcgccgaa gctggccctgttcagatttttgtctccaagcatttgattccagatgatatggagtttcag gctggagacatgcctcactataccacatcagatggatcagtgtgtttctttctcaatttg tga

DBGET integrated database retrieval system