KEGG   Eutrema salsugineum (saltwater cress): EUTSA_v10014855mg
Entry
EUTSA_v10014855mg CDS       T02985                                 
Name
(RefSeq) hypothetical protein
  KO
K03094  S-phase kinase-associated protein 1
Organism
eus  Eutrema salsugineum (saltwater cress)
Pathway
eus03083  Polycomb repressive complex
eus04120  Ubiquitin mediated proteolysis
eus04141  Protein processing in endoplasmic reticulum
Brite
KEGG Orthology (KO) [BR:eus00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   04141 Protein processing in endoplasmic reticulum
    EUTSA_v10014855mg
   04120 Ubiquitin mediated proteolysis
    EUTSA_v10014855mg
  09126 Chromosome
   03083 Polycomb repressive complex
    EUTSA_v10014855mg
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:eus04131]
    EUTSA_v10014855mg
   04121 Ubiquitin system [BR:eus04121]
    EUTSA_v10014855mg
   03036 Chromosome and associated proteins [BR:eus03036]
    EUTSA_v10014855mg
Membrane trafficking [BR:eus04131]
 Endosome - Lysosome transport
  Acidification regulators
   RAVE complex
    EUTSA_v10014855mg
Ubiquitin system [BR:eus04121]
 Ubiquitin ligases (E3)
  Multi subunit type E3
   SCF complex
    Adaptor protein
     EUTSA_v10014855mg
   Cul7 complex
     EUTSA_v10014855mg
Chromosome and associated proteins [BR:eus03036]
 Eukaryotic type
  Histone modification proteins
   Polycomb repressive complex (PRC) and associated proteins
    Noncanonical PRC1 (PRC1.1)
     EUTSA_v10014855mg
  Centromeric chromatin formation proteins
   Kinetochore proteins
    CBF3 complex
     EUTSA_v10014855mg
SSDB
Motif
Pfam: Skp1 Skp1_POZ SMG1
Other DBs
NCBI-GeneID: 18017521
NCBI-ProteinID: XP_006401597
UniProt: V4KYL5
LinkDB
Position
Unknown
AA seq 167 aa
MSFLLKSSDGISFEVDKTLVHDWLIVQNVEGAFESQELTLENVTSEILTLLIAYCKKHQH
QASSASSSSTASVTSKSHADELKQWDAQFMKVSLPTLFGLIKAADYIGIESLADLTCKTL
ADLLSDKPLSEIRKTFGLKNDFTPQEKEKVLRENNWALTDQDREDLQ
NT seq 504 nt   +upstreamnt  +downstreamnt
atgtcgtttctcctgaaatcttccgacgggatttccttcgaggtagataaaactcttgtc
cacgactggttaatagtgcaaaatgttgagggtgctttcgagagtcaggaattaacgctg
gagaatgtcactagcgaaatcctcactttgctgatcgcctattgcaagaagcaccaacac
caagcctcatccgcctcctcctcctctaccgcttcggtcaccagcaagagccatgccgat
gagctcaagcaatgggacgcccaattcatgaaagtctctctcccgacgctctttggtctg
atcaaggcagctgactatattggaatcgaatctcttgctgacctcacttgtaaaacgctt
gccgatttgctgagcgacaagcctttgtctgaaatcaggaaaacgtttggtctgaagaac
gatttcactccccaggaaaaagagaaggttctcagggagaacaattgggctttgactgat
caagatcgtgaggacttgcagtag

DBGET integrated database retrieval system