Eutrema salsugineum (saltwater cress): EUTSA_v10015122mg Help Entry EUTSA_v10015122mg CDS       T02985                                  Name (RefSeq) hypothetical protein   KO K03872   elongin-C Organism eus  Eutrema salsugineum (saltwater cress) Pathway eus04120   Ubiquitin mediated proteolysis Brite KEGG Orthology (KO) [BR:eus00001]  09120 Genetic Information Processing   09123 Folding, sorting and degradation    04120 Ubiquitin mediated proteolysis     EUTSA_v10015122mg  09180 Brite Hierarchies   09182 Protein families: genetic information processing    04121 Ubiquitin system [BR:eus04121]     EUTSA_v10015122mg    03400 DNA repair and recombination proteins [BR:eus03400]     EUTSA_v10015122mg Ubiquitin system [BR:eus04121]  Ubiquitin ligases (E3)   Multi subunit type E3    Cul2 complex     Adoptor protein      EUTSA_v10015122mg    Cul5 complex      EUTSA_v10015122mg DNA repair and recombination proteins [BR:eus03400]  Eukaryotic type   SSBR (single strand breaks repair)    NER (nucleotide excision repair)     Other NER factors      EUTSA_v10015122mg BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  Skp1_POZ BTB Motif Other DBs NCBI-GeneID:  18017973 NCBI-ProteinID:  XP_006400994 UniProt:  V4LJ30 LinkDB All DBs Position Unknown AA seq 96 aa AA seqDB search MRETVKLISMEGFEFVIDREAAMVSQTIRSMLTSPGGFSESKDGVVTFPDISTTILEKIC QYFYWSLQYSRGKETEFHIEPELTLELMMAANYLHT NT seq 291 nt NT seq  +upstreamnt  +downstreamnt atgagggagacggtgaagttgataagcatggagggtttcgagttcgtcatcgacagggaa gccgccatggtttctcagaccatccgaagcatgctcacttctccaggtggtttttcggaa tcgaaagacggtgtcgtgactttccctgatatcagcaccacaattttagagaagatctgc cagtacttctattggtctcttcaatactcaagaggcaaagagacagagttccacatcgag cctgaactgactttggagctgatgatggctgctaactatcttcacacttga

DBGET integrated database retrieval system