Eutrema salsugineum (saltwater cress): EUTSA_v10015128mg Help Entry EUTSA_v10015128mg CDS       T02985                                  Name (RefSeq) hypothetical protein   KO K03873   elongin-B Organism eus  Eutrema salsugineum (saltwater cress) Pathway eus04120   Ubiquitin mediated proteolysis Brite KEGG Orthology (KO) [BR:eus00001]  09120 Genetic Information Processing   09123 Folding, sorting and degradation    04120 Ubiquitin mediated proteolysis     EUTSA_v10015128mg  09180 Brite Hierarchies   09182 Protein families: genetic information processing    04121 Ubiquitin system [BR:eus04121]     EUTSA_v10015128mg    03400 DNA repair and recombination proteins [BR:eus03400]     EUTSA_v10015128mg Ubiquitin system [BR:eus04121]  Ubiquitin ligases (E3)   Multi subunit type E3    Cul2 complex     Adoptor protein      EUTSA_v10015128mg    Cul5 complex      EUTSA_v10015128mg DNA repair and recombination proteins [BR:eus03400]  Eukaryotic type   SSBR (single strand breaks repair)    NER (nucleotide excision repair)     Other NER factors      EUTSA_v10015128mg BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  ubiquitin UBL_UBAC1 Rad60-SLD Dsc3_N Ubiquitin_2 UCH_UBL1 Motif Other DBs NCBI-GeneID:  18016436 NCBI-ProteinID:  XP_006401159 UniProt:  V4LJK0 LinkDB All DBs Position Unknown AA seq 95 aa AA seqDB search MAMYIRVKRMKTTYFIQCDPTETVLDVKQKLFALIEQPASNQRLVLMTTEEVLEDSKSLA EQKVENDAVVALTLRKDDNEFEDVNIAQPTDFSIS NT seq 288 nt NT seq  +upstreamnt  +downstreamnt atggccatgtatattcgtgtgaagcgcatgaaaaccacttactttatccagtgcgatcca acagagactgttttggatgttaagcaaaaactgtttgccctcattgagcaaccagctagc aatcagcgtctggtcttgatgactacggaagaagtgttagaggattcgaaatctctagcg gagcagaaggttgagaatgatgcagtcgttgctctgactttgaggaaagatgataacgag tttgaggatgtcaacattgcacagcccaccgacttctcaatctcatga

DBGET integrated database retrieval system