Eutrema salsugineum (saltwater cress): EUTSA_v10021863mg Help Entry EUTSA_v10021863mg CDS       T02985                                  Name (RefSeq) hypothetical protein   KO K08336   ubiquitin-like protein ATG12 Organism eus  Eutrema salsugineum (saltwater cress) Pathway eus04136   Autophagy - other Brite KEGG Orthology (KO) [BR:eus00001]  09140 Cellular Processes   09141 Transport and catabolism    04136 Autophagy - other     EUTSA_v10021863mg  09180 Brite Hierarchies   09182 Protein families: genetic information processing    04131 Membrane trafficking [BR:eus04131]     EUTSA_v10021863mg    04121 Ubiquitin system [BR:eus04121]     EUTSA_v10021863mg    03029 Mitochondrial biogenesis [BR:eus03029]     EUTSA_v10021863mg Membrane trafficking [BR:eus04131]  Autophagy   Autophagosome formation proteins    Atg12 conjugation proteins     EUTSA_v10021863mg Ubiquitin system [BR:eus04121]  Ubiquitins and ubiquitin-like proteins   Ubiquitin-like proteins (UBLs)    EUTSA_v10021863mg Mitochondrial biogenesis [BR:eus03029]  Mitochondrial quality control factors   Mitophagy factors    Autophagy-related proteins     EUTSA_v10021863mg BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  APG12 Motif Other DBs NCBI-GeneID:  18024134 NCBI-ProteinID:  XP_006407143 UniProt:  V4NPX5 LinkDB All DBs Position Unknown AA seq 71 aa AA seqDB search MATESPSSFRKIVVHLRATGGAPILKQSKFKFVYVNSAFSPNPDESVIDLYNNFGIDGKL VVNYACSMAWG NT seq 216 nt NT seq  +upstreamnt  +downstreamnt atggcgaccgaatctccgagctcctttcgaaaaattgttgttcatctaagagctaccgga ggtgctccaatactgaaacaatctaaattcaagtttgtctatgtaaacagcgctttctcg cctaaccccgatgaatcagtaattgatctatacaataactttgggattgatggtaaactc gtggtcaactatgcttgttccatggcatggggataa

DBGET integrated database retrieval system