Eutrema salsugineum (saltwater cress): EUTSA_v10022334mg Help Entry EUTSA_v10022334mg CDS       T02985                                  Name (RefSeq) hypothetical protein   KO K10418   dynein light chain LC8-type Organism eus  Eutrema salsugineum (saltwater cress) Pathway eus04814   Motor proteins Brite KEGG Orthology (KO) [BR:eus00001]  09140 Cellular Processes   09142 Cell motility    04814 Motor proteins     EUTSA_v10022334mg  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    03037 Cilium and associated proteins [BR:eus03037]     EUTSA_v10022334mg    04812 Cytoskeleton proteins [BR:eus04812]     EUTSA_v10022334mg Cilium and associated proteins [BR:eus03037]  Motile cilia and associated proteins   Dynein arm    EUTSA_v10022334mg Cytoskeleton proteins [BR:eus04812]  Eukaryotic cytoskeleton proteins   Microtubules    Tubulin-binding proteins     Dyneins      EUTSA_v10022334mg BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  Dynein_light Motif Other DBs NCBI-GeneID:  18024268 NCBI-ProteinID:  XP_006406875 UniProt:  V4M7I7 LinkDB All DBs Position Unknown AA seq 93 aa AA seqDB search MLEGKAKVEETDMPVKMQMQAMGIASQSLDLFDVFDCQSIAAHIKKEFDERYGSGWQCVV GSKFGCFFTHSKGTFIFFHLGTLDFLIFKSVTL NT seq 282 nt NT seq  +upstreamnt  +downstreamnt atgttggaagggaaagcgaaggtggaagagacagatatgccagtgaagatgcaaatgcaa gcgatgggcattgcttctcaatctctcgatctttttgatgtctttgactgtcaatccatc gctgctcacatcaagaaggagtttgatgaaaggtatggaagtggatggcaatgtgtggtg ggatcaaaatttgggtgtttctttacacattctaaaggaactttcatcttttttcatttg gggaccctcgactttctcatcttcaaaagcgtaactctttag

DBGET integrated database retrieval system