KEGG   Eutrema salsugineum (saltwater cress): EUTSA_v10024982mg
Entry
EUTSA_v10024982mg CDS       T02985                                 
Name
(RefSeq) hypothetical protein
  KO
K12156  (methylthio)alkanaldoxime N-monooxygenase [EC:1.14.14.43]
Organism
eus  Eutrema salsugineum (saltwater cress)
Pathway
eus00966  Glucosinolate biosynthesis
eus01110  Biosynthesis of secondary metabolites
eus01210  2-Oxocarboxylic acid metabolism
Brite
KEGG Orthology (KO) [BR:eus00001]
 09100 Metabolism
  09110 Biosynthesis of other secondary metabolites
   00966 Glucosinolate biosynthesis
    EUTSA_v10024982mg
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   00199 Cytochrome P450 [BR:eus00199]
    EUTSA_v10024982mg
Enzymes [BR:eus01000]
 1. Oxidoreductases
  1.14  Acting on paired donors, with incorporation or reduction of molecular oxygen
   1.14.14  With reduced flavin or flavoprotein as one donor, and incorporation of one atom of oxygen into the other donor
    1.14.14.43  (methylsulfanyl)alkanaldoxime N-monooxygenase
     EUTSA_v10024982mg
Cytochrome P450 [BR:eus00199]
 Cytochrome P450, plant type
  CYP83 family
   EUTSA_v10024982mg
SSDB
Motif
Pfam: p450 PCP_red
Other DBs
NCBI-GeneID: 18030058
NCBI-ProteinID: XP_006414858
UniProt: V4P9G6
LinkDB
Position
Unknown
AA seq 501 aa
MEDIIIGVVALVAVLLFFLSQKTNTKRYKLPPGPKALPLIGNLHQLQQTNPQRFFHGWAK
NYGPILSYKIGNRIMMVVSSAELTKELLKTQDVNFANRPPHRGHVLMTYGRSDMAMNHYT
PLYREMRKMGMNHLFSPTRVATFKHVREEEAKHMMAKIEKAAERSEPVDISELMLTFTNT
VVCRQAFGKKYNEDGEEMKRFIKILYGTQSVLGKIFFSDFFPFSGFLDNWTGLTKYMMDC
FERQDTYIQEIIDETLDPNRVKPETESMIDLLMEVYKEQPFASKFTIGNVKGVILNIVVA
GTDTAAAAVVWGMTYLMKYPEVRKKAQAEVRDYAREKGLTFITEDDIKNLPYFRALVKET
LRIEPVIPLLIPRCCIQDTKIAGYDVPAGTTVNVNAWAVSRDEKEWGPNPDEFRPERFLE
KDVDFKGTDYEFIPFGSGRRMCPGMRLGAVMIEVPYANLLLNFDFKLPNGMKPEDINMDV
MTGLAMHKAVHLKLVPEKVSK
NT seq 1506 nt   +upstreamnt  +downstreamnt
atggaagatattatcatcggcgttgtggcactcgtcgcggttcttctcttcttcctttct
caaaaaacgaacaccaaacggtacaagctgcctcccggtccaaaggcgcttcccctgatc
ggaaacctccaccagcttcagcagactaacccacaacgtttcttccatggatgggccaaa
aattacggtccgatcttgtcatataagataggaaacagaataatgatggtggtatcttcg
gctgagctaaccaaagagcttctcaagacgcaagatgtcaactttgctaaccggcctccg
caccgtggtcacgtgctcatgacctacggaagaagtgacatggctatgaaccactacaca
ccgttgtaccgggagatgaggaagatgggcatgaaccacttgttctcacccactcgtgtg
gccacctttaagcacgtgcgggaggaggaggctaagcatatgatggctaagatcgaaaag
gctgcggagagatctgaaccggtcgatataagcgagcttatgttgaccttcacgaacacg
gttgtgtgtaggcaagcgtttgggaagaagtacaatgaagatggggaagagatgaagaga
ttcatcaagattctttatgggactcagagcgttttggggaagatttttttctctgacttt
ttcccgtttagtggatttctcgataattggacaggcctcacgaaatatatgatggactgt
tttgaaagacaagacacttacattcaagagattatcgatgagacgttagatcccaacagg
gtcaagccagaaactgagagcatgatagatctcttgatggaggtctacaaagagcaacca
ttcgcctccaagttcactatagggaatgtcaaaggagtgattttgaatatagtggttgcc
ggaactgacacggcggctgcagcggttgtgtgggggatgacgtatctaatgaagtaccct
gaagtgaggaagaaagctcaagcagaagtgagagattatgcaagagagaaaggtttaacg
ttcattactgaagacgacatcaagaaccttccttacttcagagccttagttaaagaaaca
ttaaggattgaaccagtgattcctctccttatccctcgttgttgcattcaagataccaag
attgctggttacgatgtccccgcggggaccacagtcaatgtaaatgcgtgggctgtgtct
cgtgatgagaaggagtggggcccgaaccctgacgagttcaggcccgagaggtttcttgag
aaggacgttgacttcaaaggcacggactatgagtttataccgtttgggtcaggccggaga
atgtgccctggaatgcgtcttggtgcggtgatgattgaggttccatacgcgaaccttttg
ctcaacttcgacttcaaacttcctaatggaatgaaaccagaagacatcaacatggatgtc
atgactggtcttgctatgcacaaggcggttcatctcaagcttgttcccgagaaggtgagc
aagtga

DBGET integrated database retrieval system