KEGG   Eutrema salsugineum (saltwater cress): EUTSA_v10025296mg
Entry
EUTSA_v10025296mg CDS       T02985                                 
Name
(RefSeq) hypothetical protein
  KO
K21623  L-cystine beta-lyase [EC:4.4.1.35]
Organism
eus  Eutrema salsugineum (saltwater cress)
Pathway
eus00270  Cysteine and methionine metabolism
eus01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:eus00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00270 Cysteine and methionine metabolism
    EUTSA_v10025296mg
Enzymes [BR:eus01000]
 4. Lyases
  4.4  Carbon-sulfur lyases
   4.4.1  Carbon-sulfur lyases (only sub-subclass identified to date)
    4.4.1.35  L-cystine beta-lyase
     EUTSA_v10025296mg
SSDB
Motif
Pfam: Aminotran_1_2 DegT_DnrJ_EryC1 Cys_Met_Meta_PP Beta_elim_lyase
Other DBs
NCBI-GeneID: 18030879
NCBI-ProteinID: XP_006413537
UniProt: V4LWI7
LinkDB
Position
Unknown
AA seq 423 aa
MMNQKCIEWQFSGSEAAKEAAAASLGTYTSELYAMCDPNGKPILPPRSESPETSPAAEKA
VVKAVLCGTGNAYAPSIGLPVAKRAVAEYLNQNLPKKLTADDVFMTVGCKQAIELAVDIL
AKPKANVLLPRPGFPWDVVRSIYKHLEVRYYDFIPEKDFEIDFDSVRKMVDKNTFAIFII
NPHNPNGNTYSECHLKQLAELAKELSIMVVSDEVYRWTVFGSNPFVPMGKFSSIVPVVTL
GSISKGWSVPGWRTGWLALHDLDGVFKSTKILQAAKEFLEINSKPPTVIQAAIPDILERT
PKEFFDKRGSFLKDKVDFGYSKLKHIPNLTCYMKPEACTFLWTELDLSCFVSIEDDQDFC
KKLAMEENLVVLPGIAFSQKNWLRHSIDMDTPTLEDAFERLKSFCERHSITGEASLKNVN
GVN
NT seq 1272 nt   +upstreamnt  +downstreamnt
atgatgaaccaaaagtgcattgagtggcagttcagcgggagcgaggcggccaaagaagct
gccgcagcttccctaggcacctacacctctgaactctacgctatgtgtgatcctaatggc
aagcccattttgcccccaagaagcgagtcaccagagaccagccctgcagctgaaaaagct
gttgttaaagccgttctatgcggcacgggaaacgcctacgctcctagcattggccttccg
gtcgccaaacgtgccgtagcagaatatctaaaccaaaatcttccgaagaagctaacagca
gatgacgtgtttatgactgtgggatgcaaacaagcgatcgagctcgctgtggacattctt
gctaaaccgaaagccaacgttttgcttccaaggccaggcttcccttgggacgtagtccgc
tccatctacaagcaccttgaggtccgctactatgacttcatccctgaaaaagactttgag
atcgacttcgatagcgtgagaaagatggtagacaagaacacgtttgccatatttataata
aacccccacaatcccaatgggaacacctactccgagtgtcatctcaagcagcttgctgag
ttggctaaggaactctcgataatggtggtttctgatgaagtttatagatggacagtcttt
gggagtaacccttttgttccgatgggaaaattctcgtcaatcgtaccagtggttacactc
ggatccatatctaagggttggagtgtccctggatggcgaactggctggctcgcgctgcat
gatctagatggcgtcttcaaaagcaccaagatcttacaagctgccaaagaatttctcgag
ataaactctaaacctccaactgttattcaggcggctattcctgatattttggagagaact
cctaaagagttcttcgataagagggggagttttctgaaagataaagtagattttggatat
tctaagctcaagcacatacctaacctcacctgctacatgaaacctgaagcttgcaccttc
ttatggaccgagctggatttatcgtgctttgtgagcattgaagacgatcaagacttctgc
aagaagcttgctatggaagaaaaccttgttgttttaccagggattgcattcagtcagaag
aattggctgaggcattctattgacatggacactccaactttggaggatgcgtttgaaaga
ttgaagagtttctgtgaacgccattccattacaggtgaagcttcacttaaaaacgtcaat
ggcgtcaactaa

DBGET integrated database retrieval system