Eutrema salsugineum (saltwater cress): EUTSA_v10026733mg Help Entry EUTSA_v10026733mg CDS       T02985                                  Name (RefSeq) hypothetical protein   KO K07342   protein transport protein SEC61 subunit gamma and related proteins Organism eus  Eutrema salsugineum (saltwater cress) Pathway eus03060   Protein export eus04141   Protein processing in endoplasmic reticulum eus04145   Phagosome Brite KEGG Orthology (KO) [BR:eus00001]  09120 Genetic Information Processing   09123 Folding, sorting and degradation    03060 Protein export     EUTSA_v10026733mg    04141 Protein processing in endoplasmic reticulum     EUTSA_v10026733mg  09140 Cellular Processes   09141 Transport and catabolism    04145 Phagosome     EUTSA_v10026733mg  09180 Brite Hierarchies   09182 Protein families: genetic information processing    04131 Membrane trafficking [BR:eus04131]     EUTSA_v10026733mg   09183 Protein families: signaling and cellular processes    02044 Secretion system [BR:eus02044]     EUTSA_v10026733mg Membrane trafficking [BR:eus04131]  Endoplasmic reticulum (ER) - Golgi transport   Others    SEC61 complex     EUTSA_v10026733mg Secretion system [BR:eus02044]  Sec (secretion) system   Eukaryotic Sec-SRP protein    EUTSA_v10026733mg BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  SecE DUF2976 Motif Other DBs NCBI-GeneID:  18030342 NCBI-ProteinID:  XP_006413371 UniProt:  V4NC79 LinkDB All DBs Position Unknown AA seq 69 aa AA seqDB search MDAIDSVVDPLRDFAKDSIRLVKRCHKPDRKEFTKVAVRTAIGFVVMGFVGFFVKLIFIP INNIIVGAT NT seq 210 nt NT seq  +upstreamnt  +downstreamnt atggatgccatcgattccgtcgtcgatcctcttagagacttcgccaaggacagtattcgc ctcgttaagcgttgtcacaagccagatcgcaaagaattcacgaaagtggcggtccgtaca gccatcgggttcgtagtaatgggattcgtgggcttctttgtgaagctcatctttattccg attaacaacatcatcgtcggtgccacttag

DBGET integrated database retrieval system