Enterobacter hormaechei subsp. xiangfangensis: BFV63_12945
Help
Entry
BFV63_12945 CDS
T04821
Name
(GenBank) muramoyltetrapeptide carboxypeptidase
KO
K01297
muramoyltetrapeptide carboxypeptidase [EC:
3.4.17.13
]
Organism
exf
Enterobacter hormaechei subsp. xiangfangensis
Brite
KEGG Orthology (KO) [BR:
exf00001
]
09180 Brite Hierarchies
09181 Protein families: metabolism
01002 Peptidases and inhibitors [BR:
exf01002
]
BFV63_12945
01011 Peptidoglycan biosynthesis and degradation proteins [BR:
exf01011
]
BFV63_12945
Enzymes [BR:
exf01000
]
3. Hydrolases
3.4 Acting on peptide bonds (peptidases)
3.4.17 Metallocarboxypeptidases
3.4.17.13 muramoyltetrapeptide carboxypeptidase
BFV63_12945
Peptidases and inhibitors [BR:
exf01002
]
Serine peptidases
Family S66
BFV63_12945
Peptidoglycan biosynthesis and degradation proteins [BR:
exf01011
]
Precursor biosynthesis
Carboxypeptidase
BFV63_12945
BRITE hierarchy
SSDB
Ortholog
Paralog
Gene cluster
GFIT
Motif
Pfam:
Peptidase_S66C
Peptidase_S66
Motif
Other DBs
NCBI-ProteinID:
AOP91750
UniProt:
A0A837FC05
LinkDB
All DBs
Position
2694486..2695400
Genome browser
AA seq
304 aa
AA seq
DB search
MPQFHLIAPSGYCINQEAAQRGVQRLLEMGHQVENQTIIPRRMQRFAGTEAQRLSDINSL
ATLEGENTIVLAVRGGYGASRLLESIDWAGLAARQQQDPLLICGHSDFTAIQLGLLALHN
VITFSGPMLAGNFGAPELDAFTQDHFWRALQNPTFTIEWQGNGPHWECEGQLWGGNLAML
VSLIGTPWLPQITDGILVLEDINEHPFRVERMLLQLYHAGLLDRQSAIVLGSFSGSAPND
YDAGYSLETMIDFIRSHLDIPVIAGLDFGHEQQTVTLPLGARAHLVHDNSGSRLTISGHP
VLKA
NT seq
915 nt
NT seq
+upstream
nt +downstream
nt
atgcctcagtttcatctcatcgcaccgtcaggctactgcatcaatcaggaggcggcacag
cggggcgttcaacgcctgctggaaatgggccatcaggtagaaaatcagacaattatcccc
cgccgcatgcagcgttttgccggtacggaggcgcagagactgagcgatatcaacagcctg
gcgacgctggaaggtgaaaacaccattgtgctggccgtgcgcggcggctatggcgcaagc
cggctgctggagagcatcgactgggccgggctggccgcgcgccagcagcaggatccgctg
ttaatctgcggacacagcgatttcacggcgatccagctcggcctgctggcgttgcataac
gtcattacctttagcggcccgatgctggccggtaactttggcgcgccggagctggatgcg
tttacgcaggaccatttctggcgcgccctgcaaaacccgacgttcaccatcgagtggcaa
ggcaatggaccgcactgggaatgtgaaggacagctgtggggcggcaacctcgcgatgctg
gtgtcgctaattggtacgccgtggctgccgcagatcacggatggcatactggtgctggaa
gatatcaatgaacacccgttccgtgtcgaacgtatgctgttgcagctgtatcacgccggg
ctcctggatcggcagtcggccattgtgctgggcagttttagcggttcagcccccaacgat
tacgatgcaggctattccctggagacgatgattgatttcattcgttcccacctggatatc
ccggtgatcgccggcctggatttcggccatgagcagcaaaccgttacgctgccgctgggt
gcccgggcgcaccttgtacacgataattcaggcagtcggttaacaatcagcggtcatccg
gtcttaaaggcataa
DBGET
integrated database retrieval system