Exiguobacterium sp. N4-1P: A0126_05895 Help Entry A0126_05895       CDS       T10338                                  Name (GenBank) hypothetical protein   KO K02078   acyl carrier protein Organism exi  Exiguobacterium sp. N4-1P Pathway exi01100   Metabolic pathways exi01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:exi00001]  09100 Metabolism   09103 Lipid metabolism    00061 Fatty acid biosynthesis     A0126_05895    00074 Mycolic acid biosynthesis     A0126_05895   09110 Biosynthesis of other secondary metabolites    00998 Biosynthesis of various antibiotics     A0126_05895 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  PP-binding Motif Other DBs NCBI-ProteinID:  ASI35119 LinkDB All DBs Position 1162863..1163117 Genome browser AA seq 84 aa AA seqDB search MSSFLDQQRFHQIVEAQLDVILPIVVTGQERLRDELQLDSMRLLQLLVHLELEYGLVLAD EQLGQLPQMTVEMFLAALTKKEVL NT seq 255 nt NT seq  +upstreamnt  +downstreamnt atgagttccttcctcgaccagcaaagatttcatcaaatcgtcgaggcgcaactcgatgtc atcttaccgatcgtagtgacgggacaggagcggcttcgcgatgaactgcaactggattcg atgcggttgttgcagttgctcgttcatctggagcttgaatacggtctcgttctagccgac gagcaactcggacagcttccacagatgacggttgaaatgttcttagctgcgctaacaaaa aaggaggtgctttaa

DBGET integrated database retrieval system