Exiguobacterium sp. N4-1P: A0126_08865 Help Entry A0126_08865       CDS       T10338                                  Name (GenBank) HU family DNA-binding protein   KO K03530   DNA-binding protein HU-beta Organism exi  Exiguobacterium sp. N4-1P Brite KEGG Orthology (KO) [BR:exi00001]  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03032 DNA replication proteins [BR:exi03032]     A0126_08865    03036 Chromosome and associated proteins [BR:exi03036]     A0126_08865    03400 DNA repair and recombination proteins [BR:exi03400]     A0126_08865 DNA replication proteins [BR:exi03032]  Prokaryotic type   DNA Replication Initiation Factors    Initiation factors (bacterial)     A0126_08865 Chromosome and associated proteins [BR:exi03036]  Prokaryotic type   Nucleoid associated proteins    HU (heat unstable protein)     A0126_08865 DNA repair and recombination proteins [BR:exi03400]  Prokaryotic type   DSBR (double strand breaks repair)    NHEJ (non-homologous end-joining)     SHIIR (short-homology-independent illegitimate recombination)      Supressor       A0126_08865 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Bac_DNA_binding HU-HIG HU-CCDC81_bac_2 HU-CCDC81_euk_1 HU-CCDC81_euk_2 HU-DNA_bdg DUF2530 Motif Other DBs NCBI-ProteinID:  ASI35667 UniProt:  A0A248L8Q4 LinkDB All DBs Position complement(1691606..1691878) Genome browser AA seq 90 aa AA seqDB search MNKTELIQAVVEKSGLTKKDVTKVVESTFESITETLQSGEKVQLIGFGNFEVRERAARKG RNPRTKEDIEIPASKVPAFKPGKALKDAVK NT seq 273 nt NT seq  +upstreamnt  +downstreamnt atgaacaaaactgaactcattcaagcggttgtcgaaaaatcaggtcttacaaaaaaagac gtgactaaagttgttgaatcaacattcgaatcaatcactgagacactccaatctggagaa aaagtccaattgattggttttggtaacttcgaagtccgtgaacgtgccgctcgtaaaggt cgcaacccacgtacgaaagaagatatcgaaatcccagcaagcaaagtgcctgccttcaaa ccgggtaaagcattgaaagatgcagtcaagtaa

DBGET integrated database retrieval system