KEGG   Eggerthella sp. YY7918: EGYY_02030
Entry
EGYY_02030        CDS       T01566                                 
Name
(GenBank) hypothetical protein
Organism
eyy  Eggerthella sp. YY7918
SSDB
Motif
Pfam: GntR HTH_36 HTH_41 HTH_Crp_2 E3_binding RepL Rrf2 HTH_24
Other DBs
NCBI-ProteinID: BAK43443
LinkDB
Position
204294..204797
AA seq 167 aa
MILHIDQKADEPLYLQIHNQIIAAIARGELRPGAALPSVRALASDLGINLHTVNKAYAVL
RDEGYVLMRGRSGAYIADPCEDDRADRARIELAKMEDELFELALAHRARGGSWGEFLECA
QTQVARAYGAGERTDVDPASDSASASTVAKTRRGGTSSREAAVGGVH
NT seq 504 nt   +upstreamnt  +downstreamnt
atgattttgcatatagatcagaaggctgacgagccgctgtatctgcaaatacataaccag
attattgccgctattgcgcgcggtgagctgcggccaggtgccgcgctgccctccgtgcgg
gcactcgcaagcgaccttggcattaacctgcataccgtgaacaaggcctatgccgtgctg
cgcgacgaagggtatgtgctcatgcgcggccgcagcggcgcgtacattgccgatccgtgc
gaggacgatcgcgccgaccgtgcgcgcatcgagttggcgaagatggaggacgagctgttc
gagctggcgctggcacaccgtgcgcgcggcggcagctggggtgagtttcttgagtgcgcg
caaacccaggtggctcgcgcctacggggcgggtgagcgtacggacgtcgaccccgcttcg
gattcggcatcggcatcgactgtcgcgaaaacccgccgtgggggaacttcttcgcgtgaa
gctgctgtagggggtgtgcattga

DBGET integrated database retrieval system